Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS55_1|g1820.t1
Gene name
Locationscaffold_008:102306..103689
Strand-
Gene length (bp)1383
Transcript length (bp)1323
Coding sequence length (bp)1323
Protein length (aa) 441

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2) 1.4E-28 99 387

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999424

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 8 (None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup5022
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g4258.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g7049.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g392.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g2244.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g8777.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g1265.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g5945.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g2447.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g4554.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g7237.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g5112.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g4835.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g4230.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g8360.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g5076.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g600.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g2246.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g3602.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g4307.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g4742.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g3543.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g1820.t1 (this protein)
Aspergillus niger CBS 630.78 Ani_SJS18_1|g2727.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g6466.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS55_1|g1820.t1
MRFLTGLLVATLSTTTASYQFNPLHHLAGIAPYFSSHDPPINPAPPAGCNVTRAAYLVRHAAIYANDFDYETYIE
PFVEKLRNTTQSWANTDSLSFLVNWTAPITEDHLEKLTRVGLQEATTLGIKFRQRYPDLHTDKVWAATAERTTKS
AQGFITGYTNNKTHVDLVSVAQSDTTGADSLTPYKSCPAYSSSYGSSYEDEFIENYTGPIIKRLNALAPKFNFTS
SDVTAMFELCGYETVIRGSSPFCSSSLFTNIEWLSFEYANDIMYFHNTGYGRPVSPVIGFPWVNASYNLLSAATS
EQDIYVSFTHREVPPTIVTALGLFNNSAYSGADNVNVTMPTDEVNYDRAWKSSNILPFLGNIGIERMECSGTQNG
FDEGVYFRVLVNEAVKPLIGCRDGPGDSCSADKFAEFISEKGKRFGDFGGICGNSSALETLDIYS*
Coding >Ani_SJS55_1|g1820.t1
ATGAGGTTCCTTACAGGTCTCCTCGTTGCCACTCTATCCACCACAACGGCATCCTACCAGTTCAATCCTCTCCAC
CATCTTGCCGGTATCGCTCCCTACTTCAGCTCTCATGATCCCCCGATCAATCCAGCTCCCCCCGCTGGCTGCAAT
GTCACACGCGCGGCCTATCTCGTCCGCCATGCTGCCATCTACGCCAACGACTTCGACTACGAGACTTACATCGAG
CCGTTCGTTGAGAAGCTGCGCAACACAACGCAAAGCTGGGCCAACACCGACTCGCTCTCCTTCCTCGTCAATTGG
ACCGCGCCGATCACCGAGGACCACCTCGAAAAGCTGACTCGCGTCGGACTCCAAGAGGCAACAACCCTAGGCATT
AAGTTCCGCCAGCGATACCCTGACTTGCACACCGACAAAGTCTGGGCCGCAACTGCTGAGCGGACGACCAAATCT
GCCCAGGGCTTCATAACCGGCTACACCAACAACAAAACGCACGTCGACCTTGTCAGCGTTGCACAGAGCGACACG
ACCGGCGCGGACTCCCTGACACCTTATAAATCCTGTCCAGCATACAGTTCAAGCTATGGCAGCAGTTACGAAGAT
GAATTTATCGAAAATTACACAGGCCCCATTATCAAGCGGCTCAATGCCCTGGCCCCAAAATTCAACTTCACTTCT
TCCGATGTTACCGCTATGTTTGAGCTCTGCGGCTACGAGACTGTAATCCGAGGCTCCTCGCCATTCTGCTCCTCC
TCGCTCTTTACCAACATCGAATGGCTCTCCTTCGAGTATGCCAACGACATCATGTACTTCCACAACACGGGCTAC
GGCCGTCCAGTGTCGCCAGTGATTGGCTTCCCCTGGGTCAATGCCAGCTACAATCTCCTCTCCGCAGCTACCAGC
GAGCAAGACATCTACGTCTCCTTTACACATCGCGAAGTACCGCCAACCATTGTCACAGCGCTGGGCTTGTTCAAT
AACAGTGCTTATTCAGGCGCGGATAATGTGAATGTTACTATGCCAACGGATGAAGTGAATTATGATCGTGCCTGG
AAGAGCAGTAACATCCTGCCATTTCTGGGGAATATTGGGATTGAGCGGATGGAGTGCAGCGGTACTCAGAATGGA
TTTGATGAGGGTGTGTACTTCCGGGTGTTGGTCAATGAAGCTGTTAAGCCGCTGATCGGGTGTCGGGACGGGCCC
GGGGATAGCTGTAGTGCGGACAAGTTTGCCGAATTTATCAGCGAAAAAGGGAAGAGGTTTGGGGACTTTGGCGGT
ATATGTGGAAACTCTTCTGCTTTGGAGACTTTGGATATCTATAGCTAA
Transcript >Ani_SJS55_1|g1820.t1
ATGAGGTTCCTTACAGGTCTCCTCGTTGCCACTCTATCCACCACAACGGCATCCTACCAGTTCAATCCTCTCCAC
CATCTTGCCGGTATCGCTCCCTACTTCAGCTCTCATGATCCCCCGATCAATCCAGCTCCCCCCGCTGGCTGCAAT
GTCACACGCGCGGCCTATCTCGTCCGCCATGCTGCCATCTACGCCAACGACTTCGACTACGAGACTTACATCGAG
CCGTTCGTTGAGAAGCTGCGCAACACAACGCAAAGCTGGGCCAACACCGACTCGCTCTCCTTCCTCGTCAATTGG
ACCGCGCCGATCACCGAGGACCACCTCGAAAAGCTGACTCGCGTCGGACTCCAAGAGGCAACAACCCTAGGCATT
AAGTTCCGCCAGCGATACCCTGACTTGCACACCGACAAAGTCTGGGCCGCAACTGCTGAGCGGACGACCAAATCT
GCCCAGGGCTTCATAACCGGCTACACCAACAACAAAACGCACGTCGACCTTGTCAGCGTTGCACAGAGCGACACG
ACCGGCGCGGACTCCCTGACACCTTATAAATCCTGTCCAGCATACAGTTCAAGCTATGGCAGCAGTTACGAAGAT
GAATTTATCGAAAATTACACAGGCCCCATTATCAAGCGGCTCAATGCCCTGGCCCCAAAATTCAACTTCACTTCT
TCCGATGTTACCGCTATGTTTGAGCTCTGCGGCTACGAGACTGTAATCCGAGGCTCCTCGCCATTCTGCTCCTCC
TCGCTCTTTACCAACATCGAATGGCTCTCCTTCGAGTATGCCAACGACATCATGTACTTCCACAACACGGGCTAC
GGCCGTCCAGTGTCGCCAGTGATTGGCTTCCCCTGGGTCAATGCCAGCTACAATCTCCTCTCCGCAGCTACCAGC
GAGCAAGACATCTACGTCTCCTTTACACATCGCGAAGTACCGCCAACCATTGTCACAGCGCTGGGCTTGTTCAAT
AACAGTGCTTATTCAGGCGCGGATAATGTGAATGTTACTATGCCAACGGATGAAGTGAATTATGATCGTGCCTGG
AAGAGCAGTAACATCCTGCCATTTCTGGGGAATATTGGGATTGAGCGGATGGAGTGCAGCGGTACTCAGAATGGA
TTTGATGAGGGTGTGTACTTCCGGGTGTTGGTCAATGAAGCTGTTAAGCCGCTGATCGGGTGTCGGGACGGGCCC
GGGGATAGCTGTAGTGCGGACAAGTTTGCCGAATTTATCAGCGAAAAAGGGAAGAGGTTTGGGGACTTTGGCGGT
ATATGTGGAAACTCTTCTGCTTTGGAGACTTTGGATATCTATAGCTAA
Gene >Ani_SJS55_1|g1820.t1
ATGAGGTTCCTTACAGGTCTCCTCGTTGCCACTCTATCCACCACAACGGCATCCTACCAGTTCAATCCTCTCCAC
CATCTTGCCGGTATCGCTCCCTACTTCAGCTCTCATGATCCCCCGATCAATCCAGCTCCCCCCGCTGGCTGCAAT
GTCACACGCGCGGCCTATCTCGTCCGCCATGCTGCCATCTACGCCAACGACTTCGACTACGAGACTTACATCGAG
CCGTTCGTTGAGAAGCTGCGCAACACAACGCAAAGCTGGGCCAACACCGACTCGCTCTCCTTCCTCGTCAATTGG
ACCGCGCCGATCACCGAGGACCACCTCGAAAAGCTGACTCGCGTCGGACTCCAAGAGGCAACAACCCTAGGCATT
AAGTTCCGCCAGCGATACCCTGACTTGCACACCGACAAAGTCTGGGCCGCAACTGCTGAGCGGACGACCAAATCT
GCCCAGGGCTTCATAACCGGCTACACCAACAACAAAACGCACGTCGACCTTGTCAGCGTTGCACAGAGCGACACG
ACCGGCGCGGACTCCCTGACACCTTATAAATCCTGTCCAGCATACAGTTCAAGCTATGGCAGCAGTTACGAAGAT
GTAAGTCTATACCTGCCCCACCCCCACTCCACCCAGTGACTTTAACTAACAGTGTCCTAGGAATTTATCGAAAAT
TACACAGGCCCCATTATCAAGCGGCTCAATGCCCTGGCCCCAAAATTCAACTTCACTTCTTCCGATGTTACCGCT
ATGTTTGAGCTCTGCGGCTACGAGACTGTAATCCGAGGCTCCTCGCCATTCTGCTCCTCCTCGCTCTTTACCAAC
ATCGAATGGCTCTCCTTCGAGTATGCCAACGACATCATGTACTTCCACAACACGGGCTACGGCCGTCCAGTGTCG
CCAGTGATTGGCTTCCCCTGGGTCAATGCCAGCTACAATCTCCTCTCCGCAGCTACCAGCGAGCAAGACATCTAC
GTCTCCTTTACACATCGCGAAGTACCGCCAACCATTGTCACAGCGCTGGGCTTGTTCAATAACAGTGCTTATTCA
GGCGCGGATAATGTGAATGTTACTATGCCAACGGATGAAGTGAATTATGATCGTGCCTGGAAGAGCAGTAACATC
CTGCCATTTCTGGGGAATATTGGGATTGAGCGGATGGAGTGCAGCGGTACTCAGAATGGATTTGATGAGGGTGTG
TACTTCCGGGTGTTGGTCAATGAAGCTGTTAAGCCGCTGATCGGGTGTCGGGACGGGCCCGGGGATAGCTGTAGT
GCGGACAAGTTTGCCGAATTTATCAGCGAAAAAGGGAAGAGGTTTGGGGACTTTGGCGGTATATGTGGAAACTCT
TCTGCTTTGGAGACTTTGGATATCTATAGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail