Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS39_1|g900.t1
Gene name
Locationscaffold_004:95765..99424
Strand+
Gene length (bp)3659
Transcript length (bp)3132
Coding sequence length (bp)3132
Protein length (aa) 1044

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 9.4E-61 53 484
PF00501 AMP-binding AMP-binding enzyme 1.2E-27 524 735
PF00501 AMP-binding AMP-binding enzyme 4.4E-16 752 822
PF00550 PP-binding Phosphopantetheine attachment site 4.3E-09 927 994

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0046914 transition metal ion binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 7 NRPS-like

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup2220
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g3865.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g923.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g2611.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g2157.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g801.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g6075.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g4634.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g2072.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g6340.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g5013.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7167.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g177.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g900.t1 (this protein)
Aspergillus niger CBS 147343 Ani_SJS115_1|g437.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g4063.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g525.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g84.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g6662.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g487.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g194.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g1963.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g199.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g618.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g1771.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS39_1|g900.t1
MAINALSIAISLLVIYPISRIVYNVFFSPLSHLPGPISWSATRLPFTRALLRGTIVHDFERLHRKYGPVVRTAPD
EVSFASGDAWTDIYASRPDDRQFLKDPLWWRRQPGQPDTLLSAIHPAKHSRMRKLLAPAFTPRALRVQEAVIQRY
ASLLVDRIKDQVSVAGTDGAVIDMGPWFNFTTFDIFGDLGFGESFNCLQHSQYHPWIALLFGSVKAASFIAAARY
YPPLETLLMKCIPRSLHEKSQRHYRQIIDKIDRRLSWELQRPDIMSHLMDENGQVALPRGELNSTFMILTTTGSE
TTATVLTGILTYLVNQPEVLGRLIGEIRGRFESSQDISLSVAADLPYLTAVIQEGLRLCPPVPWMLPRQVPPGGS
TVCGTWLPGGTAVSLQAYTLNRDTSRFHAASSFLPERWLPDASSNPNSNFYQDDRHAVQPFSMGPRSCLGQHLAW
AEMRLILTKLLVNFDFEAVEGKQLRWEELRTFLLVEKRPLENFGQQNLTPYGFEQPTLQQITFLSEDQINEVTQP
EDIICVISDGTIEWLLAMLAVIQSGCTYCPVDVNLPRARQQYIIESVSAKVVLVPQSNMRTAFGFLEDIKVWDVG
SLITHTAVQRNPVYRDVQENNIAVIIFTSGSKGVPKAVQLVHKSIMSLLSVPEGRLYSKPGWRIAQTLSLGFDCC
VLEVLSATCFGATLVFKDFDDPLAHLNRVDAMVATPSLLATLEPKNYRNLRRTRKSALAGLRRGRESTSLTKSNG
LYQVGVKGEIYISGVQVTPGYRNNAAQTASTFLPDLLVGGPQKRFKTGDMGRLMRDGYIEYIGREDDLFKIRGFR
VDLGDIEASILALAPEVDNIAVIVAPSADLLIAFATPMSVNIPILHEKIKNNIPARMVPTHILALPDLPLSPNHK
VDRRKLASMEISLARATVPLTTPTERLIAEVWRELLGQSPITEQIGASDHFLEMGGHSLLQIRVAQPLSQALNIS
FPLRLVIQYPILRELSQAIEMEVLARKECNSRSSFRSFKSVSRTGDLPVSFLEEELLINDLLSASSRR*
Coding >Ani_SJS39_1|g900.t1
ATGGCCATTAACGCTTTGAGTATAGCTATCTCCCTGCTGGTGATTTATCCCATAAGCCGCATTGTTTACAATGTG
TTTTTCAGTCCATTGAGCCATTTACCCGGGCCAATTAGCTGGTCTGCCACTCGTTTGCCGTTTACCAGGGCACTA
CTTCGGGGCACGATTGTCCATGACTTCGAAAGATTGCATCGCAAGTACGGCCCAGTTGTTCGCACCGCCCCTGAC
GAGGTCAGCTTTGCCAGCGGTGACGCTTGGACCGACATCTACGCGAGTCGGCCTGACGATCGGCAATTTCTCAAA
GATCCCCTCTGGTGGCGCAGGCAGCCTGGCCAGCCTGATACTCTGTTGAGTGCAATCCATCCGGCGAAACATTCC
CGCATGCGTAAACTACTCGCGCCGGCCTTCACCCCGCGTGCCTTGAGGGTGCAGGAGGCTGTGATACAAAGATAT
GCCTCACTTCTTGTTGACCGTATCAAAGACCAAGTCTCAGTCGCTGGCACAGACGGGGCAGTGATTGACATGGGC
CCCTGGTTCAATTTCACCACATTTGACATTTTTGGCGACCTCGGCTTTGGCGAGTCCTTCAATTGTCTGCAGCAC
TCACAGTACCACCCCTGGATTGCACTTTTATTTGGTAGTGTTAAGGCGGCATCATTCATTGCGGCAGCGCGGTAT
TACCCCCCGTTGGAAACGCTACTGATGAAATGCATCCCCCGCTCGCTGCATGAAAAGAGTCAACGCCATTACCGG
CAAATCATCGACAAGATCGACCGACGGCTCAGCTGGGAGCTTCAGCGACCGGACATCATGTCTCACCTAATGGAT
GAGAATGGCCAAGTGGCATTACCACGGGGAGAGCTCAATTCGACCTTTATGATTTTGACTACAACGGGCAGTGAA
ACGACTGCCACCGTGTTGACGGGCATTCTGACCTATCTAGTGAATCAACCAGAAGTTTTGGGGCGCCTCATCGGG
GAGATCCGTGGGAGGTTCGAATCTAGTCAAGACATCAGCCTGTCAGTAGCGGCGGATCTGCCGTACCTCACTGCA
GTGATTCAGGAGGGTCTCCGACTGTGTCCACCTGTGCCGTGGATGCTTCCCCGCCAGGTGCCGCCGGGAGGAAGC
ACGGTGTGTGGGACTTGGTTACCGGGCGGAACCGCGGTTTCCCTGCAGGCTTACACTCTCAATCGCGACACCTCT
CGGTTCCATGCAGCCTCCTCCTTTTTACCCGAGCGATGGCTCCCGGATGCTTCGAGTAATCCCAACTCCAACTTT
TACCAGGACGACCGTCACGCCGTGCAGCCGTTCAGCATGGGACCGCGGTCTTGTCTAGGTCAGCACCTGGCATGG
GCGGAGATGAGGTTGATCCTTACCAAGTTACTGGTCAATTTTGACTTCGAGGCGGTAGAGGGGAAACAGTTGCGA
TGGGAAGAATTGCGGACCTTCTTGTTGGTGGAGAAGCGCCCCTTGGAGAACTTCGGCCAGCAAAATCTCACACCA
TATGGTTTCGAGCAACCTACTCTTCAGCAAATAACATTTCTGTCTGAGGATCAGATCAATGAAGTTACCCAGCCG
GAAGACATTATTTGCGTCATCAGTGACGGTACCATCGAATGGCTCTTGGCAATGCTGGCGGTCATCCAATCCGGC
TGCACATACTGTCCAGTTGACGTGAATCTTCCTCGGGCGCGGCAGCAGTATATAATCGAGTCCGTCTCCGCTAAG
GTGGTTTTGGTCCCGCAATCCAACATGCGGACCGCATTTGGCTTCCTTGAGGATATCAAGGTGTGGGACGTAGGT
AGTCTAATCACGCATACGGCGGTACAGCGGAACCCGGTTTATCGTGATGTCCAGGAGAACAACATCGCGGTGATC
ATATTCACCTCGGGAAGCAAGGGCGTCCCCAAAGCCGTACAGCTGGTTCATAAGAGTATCATGTCTCTGCTCTCT
GTTCCGGAGGGTCGGCTCTACTCCAAGCCTGGGTGGCGCATCGCGCAGACACTGTCGCTGGGGTTTGACTGCTGC
GTGCTGGAAGTCCTCTCGGCCACCTGTTTTGGCGCAACGTTGGTCTTTAAGGATTTCGATGACCCACTCGCTCAC
CTGAATAGGGTCGATGCGATGGTTGCAACGCCTTCTCTTTTAGCGACGCTGGAGCCCAAAAACTATAGAAACCTA
CGGCGCACGAGAAAGTCAGCATTGGCAGGCCTACGCCGAGGACGCGAATCTACATCCTTGACAAAAAGCAACGGC
CTGTACCAAGTCGGGGTCAAAGGTGAGATCTACATCTCGGGAGTTCAAGTTACTCCCGGGTATCGCAACAATGCT
GCTCAAACAGCGTCTACGTTCTTACCTGATCTCCTCGTTGGTGGGCCTCAGAAGAGGTTTAAGACTGGAGACATG
GGCCGTCTGATGCGCGACGGATATATCGAGTACATTGGACGAGAAGACGACTTGTTCAAAATCCGTGGATTCAGA
GTCGACCTGGGAGATATCGAAGCCTCAATTCTGGCCCTCGCTCCCGAGGTGGACAACATTGCGGTCATCGTGGCC
CCTTCGGCCGATCTTCTCATTGCGTTTGCCACTCCCATGTCGGTCAATATCCCGATCTTGCATGAAAAGATCAAG
AACAATATTCCAGCCCGTATGGTTCCCACACACATACTGGCTCTCCCTGATCTACCACTGTCACCAAATCACAAG
GTTGACCGTAGGAAGCTGGCAAGTATGGAAATATCGCTCGCACGCGCGACCGTACCCCTGACGACACCAACGGAG
AGGCTCATCGCGGAGGTCTGGCGTGAGCTGCTTGGACAATCACCCATAACAGAGCAGATCGGTGCCTCCGATCAC
TTCCTCGAAATGGGTGGCCACTCCCTACTGCAGATCCGCGTAGCACAGCCGCTAAGCCAAGCACTGAACATTTCA
TTCCCTTTGCGACTGGTTATCCAGTATCCGATCCTGAGAGAATTGAGTCAAGCAATTGAGATGGAAGTTCTCGCT
CGGAAGGAGTGCAATTCGCGCAGCAGCTTCCGCTCGTTCAAGTCTGTCTCCCGAACAGGAGACTTACCTGTGTCG
TTCCTGGAAGAAGAATTGTTAATCAACGACCTACTTTCCGCGTCCTCCCGGCGTTGA
Transcript >Ani_SJS39_1|g900.t1
ATGGCCATTAACGCTTTGAGTATAGCTATCTCCCTGCTGGTGATTTATCCCATAAGCCGCATTGTTTACAATGTG
TTTTTCAGTCCATTGAGCCATTTACCCGGGCCAATTAGCTGGTCTGCCACTCGTTTGCCGTTTACCAGGGCACTA
CTTCGGGGCACGATTGTCCATGACTTCGAAAGATTGCATCGCAAGTACGGCCCAGTTGTTCGCACCGCCCCTGAC
GAGGTCAGCTTTGCCAGCGGTGACGCTTGGACCGACATCTACGCGAGTCGGCCTGACGATCGGCAATTTCTCAAA
GATCCCCTCTGGTGGCGCAGGCAGCCTGGCCAGCCTGATACTCTGTTGAGTGCAATCCATCCGGCGAAACATTCC
CGCATGCGTAAACTACTCGCGCCGGCCTTCACCCCGCGTGCCTTGAGGGTGCAGGAGGCTGTGATACAAAGATAT
GCCTCACTTCTTGTTGACCGTATCAAAGACCAAGTCTCAGTCGCTGGCACAGACGGGGCAGTGATTGACATGGGC
CCCTGGTTCAATTTCACCACATTTGACATTTTTGGCGACCTCGGCTTTGGCGAGTCCTTCAATTGTCTGCAGCAC
TCACAGTACCACCCCTGGATTGCACTTTTATTTGGTAGTGTTAAGGCGGCATCATTCATTGCGGCAGCGCGGTAT
TACCCCCCGTTGGAAACGCTACTGATGAAATGCATCCCCCGCTCGCTGCATGAAAAGAGTCAACGCCATTACCGG
CAAATCATCGACAAGATCGACCGACGGCTCAGCTGGGAGCTTCAGCGACCGGACATCATGTCTCACCTAATGGAT
GAGAATGGCCAAGTGGCATTACCACGGGGAGAGCTCAATTCGACCTTTATGATTTTGACTACAACGGGCAGTGAA
ACGACTGCCACCGTGTTGACGGGCATTCTGACCTATCTAGTGAATCAACCAGAAGTTTTGGGGCGCCTCATCGGG
GAGATCCGTGGGAGGTTCGAATCTAGTCAAGACATCAGCCTGTCAGTAGCGGCGGATCTGCCGTACCTCACTGCA
GTGATTCAGGAGGGTCTCCGACTGTGTCCACCTGTGCCGTGGATGCTTCCCCGCCAGGTGCCGCCGGGAGGAAGC
ACGGTGTGTGGGACTTGGTTACCGGGCGGAACCGCGGTTTCCCTGCAGGCTTACACTCTCAATCGCGACACCTCT
CGGTTCCATGCAGCCTCCTCCTTTTTACCCGAGCGATGGCTCCCGGATGCTTCGAGTAATCCCAACTCCAACTTT
TACCAGGACGACCGTCACGCCGTGCAGCCGTTCAGCATGGGACCGCGGTCTTGTCTAGGTCAGCACCTGGCATGG
GCGGAGATGAGGTTGATCCTTACCAAGTTACTGGTCAATTTTGACTTCGAGGCGGTAGAGGGGAAACAGTTGCGA
TGGGAAGAATTGCGGACCTTCTTGTTGGTGGAGAAGCGCCCCTTGGAGAACTTCGGCCAGCAAAATCTCACACCA
TATGGTTTCGAGCAACCTACTCTTCAGCAAATAACATTTCTGTCTGAGGATCAGATCAATGAAGTTACCCAGCCG
GAAGACATTATTTGCGTCATCAGTGACGGTACCATCGAATGGCTCTTGGCAATGCTGGCGGTCATCCAATCCGGC
TGCACATACTGTCCAGTTGACGTGAATCTTCCTCGGGCGCGGCAGCAGTATATAATCGAGTCCGTCTCCGCTAAG
GTGGTTTTGGTCCCGCAATCCAACATGCGGACCGCATTTGGCTTCCTTGAGGATATCAAGGTGTGGGACGTAGGT
AGTCTAATCACGCATACGGCGGTACAGCGGAACCCGGTTTATCGTGATGTCCAGGAGAACAACATCGCGGTGATC
ATATTCACCTCGGGAAGCAAGGGCGTCCCCAAAGCCGTACAGCTGGTTCATAAGAGTATCATGTCTCTGCTCTCT
GTTCCGGAGGGTCGGCTCTACTCCAAGCCTGGGTGGCGCATCGCGCAGACACTGTCGCTGGGGTTTGACTGCTGC
GTGCTGGAAGTCCTCTCGGCCACCTGTTTTGGCGCAACGTTGGTCTTTAAGGATTTCGATGACCCACTCGCTCAC
CTGAATAGGGTCGATGCGATGGTTGCAACGCCTTCTCTTTTAGCGACGCTGGAGCCCAAAAACTATAGAAACCTA
CGGCGCACGAGAAAGTCAGCATTGGCAGGCCTACGCCGAGGACGCGAATCTACATCCTTGACAAAAAGCAACGGC
CTGTACCAAGTCGGGGTCAAAGGTGAGATCTACATCTCGGGAGTTCAAGTTACTCCCGGGTATCGCAACAATGCT
GCTCAAACAGCGTCTACGTTCTTACCTGATCTCCTCGTTGGTGGGCCTCAGAAGAGGTTTAAGACTGGAGACATG
GGCCGTCTGATGCGCGACGGATATATCGAGTACATTGGACGAGAAGACGACTTGTTCAAAATCCGTGGATTCAGA
GTCGACCTGGGAGATATCGAAGCCTCAATTCTGGCCCTCGCTCCCGAGGTGGACAACATTGCGGTCATCGTGGCC
CCTTCGGCCGATCTTCTCATTGCGTTTGCCACTCCCATGTCGGTCAATATCCCGATCTTGCATGAAAAGATCAAG
AACAATATTCCAGCCCGTATGGTTCCCACACACATACTGGCTCTCCCTGATCTACCACTGTCACCAAATCACAAG
GTTGACCGTAGGAAGCTGGCAAGTATGGAAATATCGCTCGCACGCGCGACCGTACCCCTGACGACACCAACGGAG
AGGCTCATCGCGGAGGTCTGGCGTGAGCTGCTTGGACAATCACCCATAACAGAGCAGATCGGTGCCTCCGATCAC
TTCCTCGAAATGGGTGGCCACTCCCTACTGCAGATCCGCGTAGCACAGCCGCTAAGCCAAGCACTGAACATTTCA
TTCCCTTTGCGACTGGTTATCCAGTATCCGATCCTGAGAGAATTGAGTCAAGCAATTGAGATGGAAGTTCTCGCT
CGGAAGGAGTGCAATTCGCGCAGCAGCTTCCGCTCGTTCAAGTCTGTCTCCCGAACAGGAGACTTACCTGTGTCG
TTCCTGGAAGAAGAATTGTTAATCAACGACCTACTTTCCGCGTCCTCCCGGCGTTGA
Gene >Ani_SJS39_1|g900.t1
ATGGCCATTAACGCTTTGAGTATAGCTATCTCCCTGCTGGTGATTGTATGCATCGCTTTCCCCACCTGGCAACTT
TTTCTCTTACAGAACCAAATACTAAAACTATTTGCTCAGTATCCCATAAGCCGCATTGTTTACAATGTGTTTTTC
AGTCCATTGAGCCATTTACCCGGGCCAATTAGCTGGTCTGCCACTCGTTTGCCGTTTACCAGGGCACTACTTCGG
GGCACGATTGTCCATGACTTCGAAAGATTGCATCGCAAGTACGGCCCAGTTGTTCGCACCGCCCCTGACGAGGTC
AGCTTTGCCAGCGGTGACGCTTGGACCGACATCTACGCGAGTCGGCCTGACGATCGGCAATTTCTCAAAGATCCC
CTCTGGTGGCGCAGGCAGCCTGGCCAGCCTGATACTCTGTTGAGTGCAATCCATCCGGCGAAACATTCCCGCATG
CGTAAACTACTCGCGCCGGCCTTCACCCCGCGTGCCTTGAGGGTGCAGGAGGCTGTGATACAAAGATATGCCTCA
CTTCTTGTTGACCGTATCAAAGACCAAGTCTCAGTCGCTGGCACAGACGGGGCAGTGATTGACATGGGCCCCTGG
TTCAATTTCACCACATTTGACATTTTTGGCGACCTCGGCTTTGGCGAGTCCTTCAATTGTCTGCAGCACTCACAG
TACCACCCCTGGATTGCACTTTTATTTGGTAGTGTTAAGGCGGCATCATTCATTGCGGCAGCGCGGTATTACCCC
CCGTTGGAAACGCTACTGATGAAATGCATCCCCCGCTCGCTGCATGAAAAGAGTCAACGCCATTACCGGCAAATC
ATCGACAAGATCGACCGACGGCTCAGCTGGGAGCTTCAGCGACCGGACATCATGTCTCACCTAATGGATGAGAAT
GGCCAAGTGGCATTACCACGGGGAGAGCTCAATTCGACCTTTATGATTTTGACTACAACGGGCAGTGAAACGACT
GCCACCGTGTTGACGGGCATTCTGACCTATCTAGTGAATCAACCAGAAGTTTTGGGGCGCCTCATCGGGGAGATC
CGTGGGAGGTTCGAATCTAGTCAAGACATCAGCCTGTCAGTAGCGGCGGATCTGCCGTACCTCACTGCAGTGATT
CAGGAGGGTCTCCGACTGTGTCCACCTGTGCCGTGGATGCTTCCCCGCCAGGTGCCGCCGGGAGGAAGCACGGTG
TGTGGGACTTGGTTACCGGGCGGAGTAAGTCAAGCAAACCCCTGGGGGTCCCTCACCCCATTTAGATATGATATG
ATCGACATCAGTATTGACAACGAAAACACGGCCAGACCGCGGTTTCCCTGCAGGCTTACACTCTCAATCGCGACA
CCTCTCGGTTCCATGCAGCCTCCTCCTTTTTACCCGAGCGATGGCTCCCGGATGCTTCGAGTAATCCCAACTCCA
ACTTTTACCAGGACGACCGTCACGCCGTGCAGCCGTTCAGCATGGGACCGCGGTCTTGTCTAGGTCAGCACCTGG
CATGGGCGGAGATGAGGTTGATCCTTACCAAGTTACTGGTCAATTTTGACTTCGAGGCGGTAGAGGGGAAACAGT
TGCGATGGGAAGAATTGCGGACCTTCTTGTTGGTGGAGAAGCGCCCCTTGGAGGTGCGAGTGCGGCTGGCCCCGG
TCAATTGACCCCGTCTTGGTGGGGCTGAATCCTTCTGAGCTTGGTCGAGCTTGTTTCTACGCAGCTAATATAGAG
GTCACTTGGCGGTTTAACTAACGTTGTCACTCGTAACCGTTCGTTTCAGAACTTCGGCCAGCAAAATCTCACACC
ATATGGTTTCGAGCAACCTACTCTTCAGCAAATAACATTTCTGTCTGAGGATCAGGTATCTAATAACTGTCATTC
GGCAAATTAGAGAATCTCATTACAACGTCTTACTCCGCAACTGAGCTGTTTCATTAACATCGTGACTTCGCAGAT
CAATGAAGTTACCCAGCCGGAAGACATTATTTGCGTCATCAGTGACGGTACCATCGAATGGCTCTTGGCAATGCT
GGCGGTCATCCAATCCGGCTGCACATACTGTCCAGTTGACGTGAATCTTCCTCGGGCGCGGCAGCAGTATATAAT
CGAGTCCGTCTCCGCTAAGGTGGTTTTGGTCCCGCAATCCAACATGCGGACCGCATTTGGCTTCCTTGAGGATAT
CAAGGTGTGGGACGTAGGTAGTCTAATCACGCATACGGCGGTACAGCGGAACCCGGTTTATCGTGATGTCCAGGA
GAACAACATCGCGGTGATCATATTCACCTCGGGAAGCAAGGGCGTCCCCAAAGCCGTACAGCTGGTTCATAAGAG
TATCATGTCTCTGCTCTCTGTTCCGGAGGGTCGGCTCTACTCCAAGCCTGGGTGGCGCATCGCGCAGACACTGTC
GCTGGGGTTTGACTGCTGCGTGCTGGAAGTCCTCTCGGCCACCTGTTTTGGCGCAACGTTGGTCTTTAAGGATTT
CGATGACCCACTCGCTCACCTGAATAGGGTCGATGCGATGGTTGCAACGCCTTCTCTTTTAGCGACGCTGGAGCC
CAAAAACTATAGAAACCTACGGGTAGGCTTTCTCCTATGAGAGGCACTCCACCAAAACCTCCTCGACAAATGGTG
TCCCGGTAGAATCGTCCACAACTGCTATGGCCCGGCTGAATGTACTCTCTTTGCCACTTACAAGCGCTTCGACGA
CGCAGCGCACGAGAAAGTCAGCATTGGCAGGCCTACGCCGAGGACGCGAATCTACATCCTTGACAAAAAGCAACG
GCCTGTACCAAGTCGGGGTCAAAGGTGAGATCTACATCTCGGGAGTTCAAGTTACTCCCGGGTATCGCAACAATG
CTGCTCAAACAGCGTCTACGTTCTTACCTGATCTCCTCGTTGGTGGGCCTCAGAAGAGGTTTAAGACTGGAGACA
TGGGCCGTCTGATGCGCGACGGATATATCGAGTACATTGGACGAGAAGACGACTTGTTCAAAATCCGTGGATTCA
GAGTCGACCTGGGAGATATCGAAGCCTCAATTCTGGCCCTCGCTCCCGAGGTGGACAACATTGCGGTCATCGTGG
CCCCTTCGGCCGATCTTCTCATTGCGTTTGCCACTCCCATGTCGGTCAATATCCCGATCTTGCATGAAAAGATCA
AGAACAATATTCCAGCCCGTATGGTTCCCACACACATACTGGCTCTCCCTGATCTACCACTGTCACCAAATCACA
AGGTTGACCGTAGGAAGCTGGCAAGTATGGAAATATCGCTCGCACGCGCGACCGTACCCCTGACGACACCAACGG
AGAGGCTCATCGCGGAGGTCTGGCGTGAGCTGCTTGGACAATCACCCATAACAGAGCAGATCGGTGCCTCCGATC
ACTTCCTCGAAATGGGTGGCCACTCCCTACTGCAGATCCGCGTAGCACAGCCGCTAAGCCAAGCACTGAACATTT
CATTCCCTTTGCGACTGGTTATCCAGTATCCGATCCTGAGAGAATTGAGTCAAGCAATTGAGATGGAAGTTCTCG
CTCGGAAGGAGTGCAATTCGCGCAGCAGCTTCCGCTCGTTCAAGTCTGTCTCCCGAACAGGAGACTTACCTGTGT
CGTTCCTGGAAGAAGAATTGTTAATCAACGACCTACTTTCCGCGTCCTCCCGGCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail