Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS39_1|g11028.t1
Gene name
Locationscaffold_182:719..3524
Strand-
Gene length (bp)2805
Transcript length (bp)2805
Coding sequence length (bp)2805
Protein length (aa) 935

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 1.1E-05 516 546
PF13374 TPR_10 Tetratricopeptide repeat 1.4E-11 547 588
PF13374 TPR_10 Tetratricopeptide repeat 7.2E-10 589 629
PF13374 TPR_10 Tetratricopeptide repeat 1.2E-13 632 671
PF13374 TPR_10 Tetratricopeptide repeat 1.2E-11 673 714
PF13374 TPR_10 Tetratricopeptide repeat 5.7E-07 715 756
PF13374 TPR_10 Tetratricopeptide repeat 2.1E-11 757 797
PF13374 TPR_10 Tetratricopeptide repeat 7.1E-12 799 839
PF13374 TPR_10 Tetratricopeptide repeat 6.0E-10 841 882
PF13424 TPR_12 Tetratricopeptide repeat 1.3E-13 511 580
PF13424 TPR_12 Tetratricopeptide repeat 1.6E-15 553 622
PF13424 TPR_12 Tetratricopeptide repeat 2.9E-13 595 664
PF13424 TPR_12 Tetratricopeptide repeat 7.4E-14 635 696
PF13424 TPR_12 Tetratricopeptide repeat 1.7E-13 675 748
PF13424 TPR_12 Tetratricopeptide repeat 5.4E-10 742 790
PF13424 TPR_12 Tetratricopeptide repeat 9.9E-12 771 831
PF13176 TPR_7 Tetratricopeptide repeat 2.7E-03 551 583
PF13176 TPR_7 Tetratricopeptide repeat 1.1E-03 635 668
PF13176 TPR_7 Tetratricopeptide repeat 9.0E-05 677 710
PF13176 TPR_7 Tetratricopeptide repeat 2.4E-02 761 794
PF17874 TPR_MalT MalT-like TPR region 1.5E-06 541 654
PF17874 TPR_MalT MalT-like TPR region 1.7E-07 671 869
PF00931 NB-ARC NB-ARC domain 6.0E-11 123 324

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0043531 ADP binding Yes
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup14
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g11074.t1
Aspergillus niger CBS 112.32 Ani_SJS6_1|g7606.t1
Aspergillus niger CBS 112.32 Ani_SJS6_1|g1966.t1
Aspergillus niger CBS 112.32 Ani_SJS6_1|g1980.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g9179.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g9499.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g11047.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g7913.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g10950.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g10704.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g10669.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g6449.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g11041.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g8303.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g10984.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g10678.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g7503.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g8364.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g7499.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g10844.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g9567.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g8602.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g2733.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g11156.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g3046.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g6094.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g10646.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g7160.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g10086.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g11028.t1 (this protein)
Aspergillus niger CBS 147343 Ani_SJS115_1|g10667.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g10456.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g7010.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g9232.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g8575.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g10737.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g10857.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g11230.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g11030.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g10538.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g11389.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g10890.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g11088.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g10130.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g7583.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g7587.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g9964.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g10834.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS39_1|g11028.t1
MSRSERETDDPYIHYGLIASGDQVMKDAKTRDSIARDLDILCFEMEAAGLMDELPSLVIRGICDYCDSHKNKMWQ
GYAALAAAAYAKALLSVVPTYCRNQSRDLKQSVWMVPLRRNPRFAGREDEITRIEGLFLQQNGPSKVAICGLGGV
GKTQIALELAYRMRKRDPNCSICWITCTSYESVEQAYMNIALKLKITDIKPAEVKEKVKAYLSHKRAGKWVVIFD
NADDMGMWSTNDITDTVLTDFLPESEQGHILFTTRSRKVAVKLVSSHVITVTEPNTEISIQILKNSLVEKTLLND
RVTALKLLEQLAFLPLAITQAAAYINENSISLSDYLQLLQDQEPHVIELLSEDFGDEMRYRDIQNPIALTWFISF
QQIQQLNKLAADYLSFFACINPRDIPQSILPHPISNKNRTDALGLLKAFSFISGGSGDKSLNLHRLVHLATRNWM
RKNQQFRVQILKTADQLGKVFPNDDHANRQVWREYLPHALSLIAEADFRKEQDKYIHLVDNICRCLYSDGRWKEA
EELGVQVMDIRKRILGSEHPDTLTSMANLASTYWKKGQWKEAEELDVQVMELRKQVLGSEHPDTLTSMANLASTY
WKKGQWKEAEELGLQVMKLRKQVLGLEHPSSLTSMANLASTYSNQGRWKEAEELEIQVIELRKQVLGPEHPSTLT
SMANLASTYHNQGRWKEAEELRVQVMELCKQVLGPKHPDTLTSMMNLVSTYWKKGQWKEVEDLEVHVMELCKQVL
GPKHPDTLTSMANLASTYSIQGRWKEAEELGVQVLELRKQVLGPEHTSTLTSMANLASTYSIQGQWKEAEVLEVQ
VLELRKRVLGPEHPSTLTSMNNLAFTWKRRGTIRSALALVKQCAELRRNVLGPDHPDTISSSDALHDWETAVDPP
IWYSRQNILAFSFLALPCLYFLSKTLFKRRVCDT*
Coding >Ani_SJS39_1|g11028.t1
ATGAGCCGTTCCGAGCGGGAAACTGATGACCCTTATATTCATTATGGCTTGATCGCTTCCGGAGATCAGGTCATG
AAAGATGCCAAGACTCGCGATTCCATTGCTCGGGATCTAGACATACTCTGTTTTGAAATGGAGGCTGCTGGACTC
ATGGACGAGCTTCCATCACTAGTCATTCGCGGCATTTGTGACTATTGTGATTCGCATAAAAACAAAATGTGGCAA
GGATATGCTGCGCTTGCGGCTGCTGCCTACGCGAAGGCTCTTCTGTCGGTGGTTCCTACTTATTGCCGCAATCAA
TCACGTGATCTAAAGCAATCAGTCTGGATGGTCCCCTTACGGAGGAACCCACGGTTCGCAGGTCGGGAAGACGAA
ATCACCAGAATCGAAGGATTGTTTCTGCAACAGAACGGACCTAGCAAGGTTGCTATCTGCGGACTAGGCGGCGTT
GGAAAGACGCAGATCGCACTTGAACTGGCTTACCGCATGCGAAAGCGAGACCCTAATTGCTCGATTTGCTGGATT
ACATGTACCAGCTATGAAAGCGTGGAACAAGCCTATATGAACATCGCCTTGAAGCTGAAAATTACCGATATAAAG
CCGGCAGAGGTGAAAGAAAAGGTCAAAGCTTATCTTAGCCACAAGAGGGCCGGGAAGTGGGTTGTTATCTTTGAT
AATGCAGATGACATGGGAATGTGGAGCACAAACGATATTACTGATACAGTATTAACAGACTTTCTTCCTGAAAGC
GAGCAGGGCCATATTCTCTTCACCACGCGCAGCCGTAAGGTAGCTGTGAAACTAGTGTCTTCCCATGTGATTACA
GTCACTGAGCCGAACACAGAAATTTCTATCCAAATTCTTAAGAACTCACTGGTTGAGAAGACACTGCTTAATGAT
CGTGTTACAGCTCTGAAACTTCTTGAGCAGCTGGCTTTTCTCCCTCTGGCGATCACCCAGGCCGCAGCGTATATC
AATGAAAACAGCATTAGCCTCTCTGATTATCTTCAGCTTTTACAGGATCAGGAGCCACATGTGATTGAACTGCTG
AGTGAAGATTTTGGAGATGAAATGCGCTACAGAGACATCCAGAATCCTATTGCTCTGACTTGGTTTATCTCCTTC
CAGCAAATTCAACAATTGAATAAATTAGCGGCGGACTATCTGTCATTCTTTGCCTGCATCAATCCTCGTGACATT
CCACAGTCCATACTTCCCCATCCGATTTCGAATAAGAACAGAACCGATGCCCTCGGTCTTCTCAAGGCCTTCTCC
TTTATTAGTGGGGGGAGCGGTGACAAATCTCTAAATCTACACCGACTAGTCCATCTTGCGACTCGGAATTGGATG
AGAAAGAACCAACAGTTCCGCGTGCAAATATTGAAAACTGCTGACCAACTGGGCAAAGTCTTCCCGAATGATGAC
CATGCCAATCGGCAGGTGTGGCGGGAATACCTACCGCATGCTCTTTCACTAATAGCAGAAGCTGACTTCCGAAAG
GAGCAAGATAAATACATCCATTTGGTCGACAATATCTGTAGGTGTCTGTATAGTGACGGACGATGGAAGGAAGCA
GAAGAGCTGGGAGTGCAGGTAATGGATATACGCAAGAGGATACTGGGGTCAGAGCACCCAGATACTCTTACCAGT
ATGGCGAACCTAGCATCGACATACTGGAAAAAGGGACAATGGAAAGAAGCAGAAGAGCTGGACGTGCAAGTAATG
GAGCTTCGCAAGCAAGTACTCGGGTCAGAGCACCCAGATACTCTTACCAGCATGGCGAATCTGGCATCGACATAC
TGGAAAAAGGGACAATGGAAAGAAGCAGAAGAGCTGGGGTTGCAAGTAATGAAGCTTCGCAAGCAAGTGCTAGGG
CTAGAGCACCCTTCTTCTCTTACTAGCATGGCGAATCTAGCATCAACATACTCAAATCAAGGCCGATGGAAAGAA
GCAGAGGAGCTGGAGATACAAGTAATAGAGCTTCGCAAGCAAGTGTTAGGGCCAGAGCACCCTTCTACTCTTACC
AGCATGGCCAATCTGGCATCCACCTACCACAATCAGGGACGATGGAAGGAAGCAGAGGAGCTGAGAGTGCAGGTA
ATGGAGCTTTGCAAGCAAGTGCTGGGGCCAAAGCACCCAGATACTCTTACCAGCATGATGAATCTGGTATCGACA
TACTGGAAAAAGGGACAATGGAAAGAAGTAGAAGACCTAGAGGTGCACGTAATGGAGCTTTGCAAGCAAGTGCTA
GGGCCAAAGCACCCAGATACTCTTACCAGCATGGCGAATCTCGCATCAACATACTCCATTCAGGGACGATGGAAA
GAAGCAGAAGAGCTGGGAGTGCAAGTGTTAGAGCTGCGCAAGCAAGTACTAGGGCCCGAGCATACTTCTACTCTT
ACCAGCATGGCGAATCTCGCATCAACATACTCCATTCAGGGACAATGGAAGGAAGCAGAAGTGCTGGAGGTGCAA
GTGTTAGAGCTACGCAAGCGAGTGCTAGGGCCCGAGCATCCTTCTACTCTTACCAGCATGAATAATCTGGCCTTT
ACATGGAAAAGACGAGGTACGATTAGAAGTGCCCTCGCTCTGGTGAAACAGTGTGCAGAGCTCCGCCGCAACGTG
CTTGGTCCAGATCACCCAGATACCATATCCTCTTCTGATGCTCTCCATGACTGGGAAACCGCGGTAGATCCCCCG
ATATGGTATAGTCGACAAAACATACTTGCTTTTTCTTTTCTTGCCTTACCTTGTCTCTACTTTCTTTCGAAGACC
CTTTTCAAGAGGAGGGTCTGCGATACTTGA
Transcript >Ani_SJS39_1|g11028.t1
ATGAGCCGTTCCGAGCGGGAAACTGATGACCCTTATATTCATTATGGCTTGATCGCTTCCGGAGATCAGGTCATG
AAAGATGCCAAGACTCGCGATTCCATTGCTCGGGATCTAGACATACTCTGTTTTGAAATGGAGGCTGCTGGACTC
ATGGACGAGCTTCCATCACTAGTCATTCGCGGCATTTGTGACTATTGTGATTCGCATAAAAACAAAATGTGGCAA
GGATATGCTGCGCTTGCGGCTGCTGCCTACGCGAAGGCTCTTCTGTCGGTGGTTCCTACTTATTGCCGCAATCAA
TCACGTGATCTAAAGCAATCAGTCTGGATGGTCCCCTTACGGAGGAACCCACGGTTCGCAGGTCGGGAAGACGAA
ATCACCAGAATCGAAGGATTGTTTCTGCAACAGAACGGACCTAGCAAGGTTGCTATCTGCGGACTAGGCGGCGTT
GGAAAGACGCAGATCGCACTTGAACTGGCTTACCGCATGCGAAAGCGAGACCCTAATTGCTCGATTTGCTGGATT
ACATGTACCAGCTATGAAAGCGTGGAACAAGCCTATATGAACATCGCCTTGAAGCTGAAAATTACCGATATAAAG
CCGGCAGAGGTGAAAGAAAAGGTCAAAGCTTATCTTAGCCACAAGAGGGCCGGGAAGTGGGTTGTTATCTTTGAT
AATGCAGATGACATGGGAATGTGGAGCACAAACGATATTACTGATACAGTATTAACAGACTTTCTTCCTGAAAGC
GAGCAGGGCCATATTCTCTTCACCACGCGCAGCCGTAAGGTAGCTGTGAAACTAGTGTCTTCCCATGTGATTACA
GTCACTGAGCCGAACACAGAAATTTCTATCCAAATTCTTAAGAACTCACTGGTTGAGAAGACACTGCTTAATGAT
CGTGTTACAGCTCTGAAACTTCTTGAGCAGCTGGCTTTTCTCCCTCTGGCGATCACCCAGGCCGCAGCGTATATC
AATGAAAACAGCATTAGCCTCTCTGATTATCTTCAGCTTTTACAGGATCAGGAGCCACATGTGATTGAACTGCTG
AGTGAAGATTTTGGAGATGAAATGCGCTACAGAGACATCCAGAATCCTATTGCTCTGACTTGGTTTATCTCCTTC
CAGCAAATTCAACAATTGAATAAATTAGCGGCGGACTATCTGTCATTCTTTGCCTGCATCAATCCTCGTGACATT
CCACAGTCCATACTTCCCCATCCGATTTCGAATAAGAACAGAACCGATGCCCTCGGTCTTCTCAAGGCCTTCTCC
TTTATTAGTGGGGGGAGCGGTGACAAATCTCTAAATCTACACCGACTAGTCCATCTTGCGACTCGGAATTGGATG
AGAAAGAACCAACAGTTCCGCGTGCAAATATTGAAAACTGCTGACCAACTGGGCAAAGTCTTCCCGAATGATGAC
CATGCCAATCGGCAGGTGTGGCGGGAATACCTACCGCATGCTCTTTCACTAATAGCAGAAGCTGACTTCCGAAAG
GAGCAAGATAAATACATCCATTTGGTCGACAATATCTGTAGGTGTCTGTATAGTGACGGACGATGGAAGGAAGCA
GAAGAGCTGGGAGTGCAGGTAATGGATATACGCAAGAGGATACTGGGGTCAGAGCACCCAGATACTCTTACCAGT
ATGGCGAACCTAGCATCGACATACTGGAAAAAGGGACAATGGAAAGAAGCAGAAGAGCTGGACGTGCAAGTAATG
GAGCTTCGCAAGCAAGTACTCGGGTCAGAGCACCCAGATACTCTTACCAGCATGGCGAATCTGGCATCGACATAC
TGGAAAAAGGGACAATGGAAAGAAGCAGAAGAGCTGGGGTTGCAAGTAATGAAGCTTCGCAAGCAAGTGCTAGGG
CTAGAGCACCCTTCTTCTCTTACTAGCATGGCGAATCTAGCATCAACATACTCAAATCAAGGCCGATGGAAAGAA
GCAGAGGAGCTGGAGATACAAGTAATAGAGCTTCGCAAGCAAGTGTTAGGGCCAGAGCACCCTTCTACTCTTACC
AGCATGGCCAATCTGGCATCCACCTACCACAATCAGGGACGATGGAAGGAAGCAGAGGAGCTGAGAGTGCAGGTA
ATGGAGCTTTGCAAGCAAGTGCTGGGGCCAAAGCACCCAGATACTCTTACCAGCATGATGAATCTGGTATCGACA
TACTGGAAAAAGGGACAATGGAAAGAAGTAGAAGACCTAGAGGTGCACGTAATGGAGCTTTGCAAGCAAGTGCTA
GGGCCAAAGCACCCAGATACTCTTACCAGCATGGCGAATCTCGCATCAACATACTCCATTCAGGGACGATGGAAA
GAAGCAGAAGAGCTGGGAGTGCAAGTGTTAGAGCTGCGCAAGCAAGTACTAGGGCCCGAGCATACTTCTACTCTT
ACCAGCATGGCGAATCTCGCATCAACATACTCCATTCAGGGACAATGGAAGGAAGCAGAAGTGCTGGAGGTGCAA
GTGTTAGAGCTACGCAAGCGAGTGCTAGGGCCCGAGCATCCTTCTACTCTTACCAGCATGAATAATCTGGCCTTT
ACATGGAAAAGACGAGGTACGATTAGAAGTGCCCTCGCTCTGGTGAAACAGTGTGCAGAGCTCCGCCGCAACGTG
CTTGGTCCAGATCACCCAGATACCATATCCTCTTCTGATGCTCTCCATGACTGGGAAACCGCGGTAGATCCCCCG
ATATGGTATAGTCGACAAAACATACTTGCTTTTTCTTTTCTTGCCTTACCTTGTCTCTACTTTCTTTCGAAGACC
CTTTTCAAGAGGAGGGTCTGCGATACTTGA
Gene >Ani_SJS39_1|g11028.t1
ATGAGCCGTTCCGAGCGGGAAACTGATGACCCTTATATTCATTATGGCTTGATCGCTTCCGGAGATCAGGTCATG
AAAGATGCCAAGACTCGCGATTCCATTGCTCGGGATCTAGACATACTCTGTTTTGAAATGGAGGCTGCTGGACTC
ATGGACGAGCTTCCATCACTAGTCATTCGCGGCATTTGTGACTATTGTGATTCGCATAAAAACAAAATGTGGCAA
GGATATGCTGCGCTTGCGGCTGCTGCCTACGCGAAGGCTCTTCTGTCGGTGGTTCCTACTTATTGCCGCAATCAA
TCACGTGATCTAAAGCAATCAGTCTGGATGGTCCCCTTACGGAGGAACCCACGGTTCGCAGGTCGGGAAGACGAA
ATCACCAGAATCGAAGGATTGTTTCTGCAACAGAACGGACCTAGCAAGGTTGCTATCTGCGGACTAGGCGGCGTT
GGAAAGACGCAGATCGCACTTGAACTGGCTTACCGCATGCGAAAGCGAGACCCTAATTGCTCGATTTGCTGGATT
ACATGTACCAGCTATGAAAGCGTGGAACAAGCCTATATGAACATCGCCTTGAAGCTGAAAATTACCGATATAAAG
CCGGCAGAGGTGAAAGAAAAGGTCAAAGCTTATCTTAGCCACAAGAGGGCCGGGAAGTGGGTTGTTATCTTTGAT
AATGCAGATGACATGGGAATGTGGAGCACAAACGATATTACTGATACAGTATTAACAGACTTTCTTCCTGAAAGC
GAGCAGGGCCATATTCTCTTCACCACGCGCAGCCGTAAGGTAGCTGTGAAACTAGTGTCTTCCCATGTGATTACA
GTCACTGAGCCGAACACAGAAATTTCTATCCAAATTCTTAAGAACTCACTGGTTGAGAAGACACTGCTTAATGAT
CGTGTTACAGCTCTGAAACTTCTTGAGCAGCTGGCTTTTCTCCCTCTGGCGATCACCCAGGCCGCAGCGTATATC
AATGAAAACAGCATTAGCCTCTCTGATTATCTTCAGCTTTTACAGGATCAGGAGCCACATGTGATTGAACTGCTG
AGTGAAGATTTTGGAGATGAAATGCGCTACAGAGACATCCAGAATCCTATTGCTCTGACTTGGTTTATCTCCTTC
CAGCAAATTCAACAATTGAATAAATTAGCGGCGGACTATCTGTCATTCTTTGCCTGCATCAATCCTCGTGACATT
CCACAGTCCATACTTCCCCATCCGATTTCGAATAAGAACAGAACCGATGCCCTCGGTCTTCTCAAGGCCTTCTCC
TTTATTAGTGGGGGGAGCGGTGACAAATCTCTAAATCTACACCGACTAGTCCATCTTGCGACTCGGAATTGGATG
AGAAAGAACCAACAGTTCCGCGTGCAAATATTGAAAACTGCTGACCAACTGGGCAAAGTCTTCCCGAATGATGAC
CATGCCAATCGGCAGGTGTGGCGGGAATACCTACCGCATGCTCTTTCACTAATAGCAGAAGCTGACTTCCGAAAG
GAGCAAGATAAATACATCCATTTGGTCGACAATATCTGTAGGTGTCTGTATAGTGACGGACGATGGAAGGAAGCA
GAAGAGCTGGGAGTGCAGGTAATGGATATACGCAAGAGGATACTGGGGTCAGAGCACCCAGATACTCTTACCAGT
ATGGCGAACCTAGCATCGACATACTGGAAAAAGGGACAATGGAAAGAAGCAGAAGAGCTGGACGTGCAAGTAATG
GAGCTTCGCAAGCAAGTACTCGGGTCAGAGCACCCAGATACTCTTACCAGCATGGCGAATCTGGCATCGACATAC
TGGAAAAAGGGACAATGGAAAGAAGCAGAAGAGCTGGGGTTGCAAGTAATGAAGCTTCGCAAGCAAGTGCTAGGG
CTAGAGCACCCTTCTTCTCTTACTAGCATGGCGAATCTAGCATCAACATACTCAAATCAAGGCCGATGGAAAGAA
GCAGAGGAGCTGGAGATACAAGTAATAGAGCTTCGCAAGCAAGTGTTAGGGCCAGAGCACCCTTCTACTCTTACC
AGCATGGCCAATCTGGCATCCACCTACCACAATCAGGGACGATGGAAGGAAGCAGAGGAGCTGAGAGTGCAGGTA
ATGGAGCTTTGCAAGCAAGTGCTGGGGCCAAAGCACCCAGATACTCTTACCAGCATGATGAATCTGGTATCGACA
TACTGGAAAAAGGGACAATGGAAAGAAGTAGAAGACCTAGAGGTGCACGTAATGGAGCTTTGCAAGCAAGTGCTA
GGGCCAAAGCACCCAGATACTCTTACCAGCATGGCGAATCTCGCATCAACATACTCCATTCAGGGACGATGGAAA
GAAGCAGAAGAGCTGGGAGTGCAAGTGTTAGAGCTGCGCAAGCAAGTACTAGGGCCCGAGCATACTTCTACTCTT
ACCAGCATGGCGAATCTCGCATCAACATACTCCATTCAGGGACAATGGAAGGAAGCAGAAGTGCTGGAGGTGCAA
GTGTTAGAGCTACGCAAGCGAGTGCTAGGGCCCGAGCATCCTTCTACTCTTACCAGCATGAATAATCTGGCCTTT
ACATGGAAAAGACGAGGTACGATTAGAAGTGCCCTCGCTCTGGTGAAACAGTGTGCAGAGCTCCGCCGCAACGTG
CTTGGTCCAGATCACCCAGATACCATATCCTCTTCTGATGCTCTCCATGACTGGGAAACCGCGGTAGATCCCCCG
ATATGGTATAGTCGACAAAACATACTTGCTTTTTCTTTTCTTGCCTTACCTTGTCTCTACTTTCTTTCGAAGACC
CTTTTCAAGAGGAGGGTCTGCGATACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail