Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS38_1|g1880.t1
Gene name
Locationscaffold_007:584464..589587
Strand+
Gene length (bp)5123
Transcript length (bp)3981
Coding sequence length (bp)3981
Protein length (aa) 1327

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.8E-81 863 1317
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 1.7E-54 315 696
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 1.6E-36 18 280
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-24 867 1260
PF07691 PA14 PA14 domain 5.6E-11 407 530

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0071704 organic substance metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 908 930 22
2 937 959 22
3 1035 1057 22
4 1120 1142 22
5 1152 1171 19
6 1184 1206 22
7 1216 1238 22
8 1251 1273 22
9 1283 1302 19

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH3 7.6E-64 31 245

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup66
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 124.48 Ani_SJS7_1|g11109.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g4980.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g9167.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g10865.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g5050.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g6306.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g3639.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7320.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g1486.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g1880.t1 (this protein)
Aspergillus niger CBS 147324 Ani_SJS39_1|g809.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g6133.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g10507.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g3900.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g1672.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g6247.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g3072.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g835.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g9536.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g9535.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g9300.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g5358.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g3651.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g3764.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g10814.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g9368.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g1298.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g5691.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g9954.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS38_1|g1880.t1
MSTLDTDTLLSHLTLEEKCQLIAGQSQWRTATIERLGIPALKVSDGPSGVRGEIFGENVPAAFLPCGVSLGATWD
QDLLYEVAQLLGDECKSKSASALLAPTICLHRHPLGGRNFEAFSEDPFLTGKLAVAYVRGIQSCGIGATPKHFAA
NDQETKRFKYNVNVAARALREVYLLPFQMVVRDADPWFMMTAYNQLNGHYCDANKELLIDIARGEWGWDGVFMSD
WGGTTSTVKSINNGLDLEMPGPPSKRSKEALEQPIKDGLIDLDRINESAGRILRLLKKAGRFDAPRDGPERCDDT
PEKRALLLRAAAAGIVMLKNENNALPLKPTVNISKLGVFGPNAKRVVAGGGGSSYIKAPYWTSVHDSICSELHAF
GTEIVFAEGARVNRYLPLCKIARDPDTGKVGAAVDWFNGHDLTGGPVVTTHIDDLYYMSFGTVPSEIGDVFSFRV
RATIKPLTSGYHAFSLASIGPATLYVNDVHHIEQSGRYEEKGSLFFTYGSEEKVAFMDFEGGRDYDLRIDYKSHN
RQFDPDLLPLLDPMENQFQGIRLGFEEADASDRPADAARLARGCDAAVVVVGRDREWETEGQDILSFDLPGEQLH
LIRAVAAVCPRTIVLIQAGTPVNMEPWVHEVSAVLYTWYQGQELGNATVDVLFGRVNPSGRLPVTFPLRIEDCPA
FSSFPGEENQVQYTEGLFVGYRWWDLLSIKPLFPLGFGLSYNKFTVSPGSISARELINEPSTPLKVTAHVVNTGG
SELPGRETVIVWFSPSSPTRLQRPKKQICGFMKSRQLLPGETDEVEIELDFHSFVLCKIASMEEVKKPEDNVQIN
INLDSSTHDDNLPVATIPFKEQLKLVMQYKRAVWAALACSTTTILIGYDLALIGSIIANTEFIKQFGVYDPASQA
WSLPANQQLVWSIIQYVSAMAAAIVSGLVNDIFGRRICFLLTVSLTITGTFVELFSTEWKTWVVAKFFMGAAMGS
MQANTQTFVSEITPTAIRGLTLSLFQFWIIVGQLIASCVLEGTSHVSSSWSWRGAVASQFGPALFCLVMFFIFVP
ESPYYLVSRDRLEDAKAALARLRAAEIDSTTLDIEVSQIQATLLHERQSRAIGSSYLECFQGINLRRTLLACLPV
IMQILTGFPLCGNYLSYFLTLSGFENAFLITVIQVIVALFAALWAFSLVERVGRRPQMLVGSSGMLLCLLVISIL
GFVGAGEGWNYSALAAFCIIWALFYYSSVGAVGWAIVGEISSPRLRAKTTSIVAFTVSLINMAWSIAIPYLVNKE
DANLGAKTGLIFLGTGLACAIVCFFCLPETKGRSFDMLDALFEMKTSARRF*
Coding >Ani_SJS38_1|g1880.t1
ATGTCTACACTCGATACAGACACGCTTCTCTCACACTTGACACTCGAGGAAAAATGTCAGTTAATCGCAGGCCAG
TCTCAATGGCGGACCGCCACAATTGAGCGCCTTGGTATTCCCGCCCTTAAGGTGTCAGATGGCCCCTCCGGAGTG
CGCGGAGAAATTTTTGGAGAGAACGTCCCGGCTGCGTTTCTACCTTGTGGCGTGAGTCTTGGAGCTACATGGGAT
CAGGATCTCCTATACGAGGTAGCGCAGCTGCTCGGGGACGAGTGCAAATCTAAATCCGCCTCGGCTTTGCTTGCC
CCGACAATCTGTCTTCATCGTCACCCTCTCGGTGGCCGGAATTTTGAAGCCTTTAGCGAGGACCCTTTCCTCACG
GGCAAACTGGCTGTTGCTTATGTTCGCGGAATCCAATCGTGTGGCATTGGCGCGACGCCAAAGCATTTTGCAGCA
AATGACCAGGAGACCAAGAGGTTCAAATACAATGTCAATGTTGCGGCCCGAGCTCTGCGTGAAGTCTACCTCTTG
CCGTTCCAGATGGTGGTCCGCGACGCGGACCCCTGGTTTATGATGACTGCCTATAATCAGTTGAATGGGCATTAC
TGCGACGCAAACAAAGAGCTACTCATTGACATCGCGCGGGGCGAATGGGGTTGGGATGGAGTCTTCATGAGTGAC
TGGGGCGGCACGACCTCAACAGTGAAGTCAATCAACAATGGCCTTGATCTGGAAATGCCCGGTCCGCCCTCCAAA
CGCTCAAAAGAGGCCCTTGAACAGCCAATTAAAGACGGGCTCATTGATTTGGATCGCATCAACGAGTCCGCGGGT
CGTATCCTACGCCTTCTCAAGAAAGCTGGTCGCTTTGATGCTCCGAGAGATGGACCCGAGAGATGTGATGACACC
CCTGAAAAGAGGGCCCTGCTCCTTCGAGCAGCAGCTGCGGGGATCGTTATGCTAAAAAACGAGAATAATGCTCTG
CCTCTCAAGCCGACAGTGAATATTTCCAAGCTTGGTGTATTCGGCCCTAACGCGAAGAGGGTAGTTGCTGGTGGA
GGTGGAAGCTCATATATCAAGGCTCCCTATTGGACTTCTGTGCACGACTCAATCTGCTCCGAGCTCCACGCCTTT
GGTACTGAGATCGTCTTTGCAGAGGGGGCTCGAGTTAACCGATACCTCCCCCTTTGCAAGATAGCGAGGGATCCA
GATACCGGCAAGGTAGGTGCGGCGGTGGACTGGTTCAATGGGCACGACCTCACAGGTGGCCCTGTAGTGACCACC
CACATTGACGATTTGTATTACATGTCCTTCGGCACCGTGCCATCCGAAATTGGTGACGTCTTCTCGTTCCGCGTC
CGAGCCACGATAAAGCCGCTTACATCGGGATATCATGCATTCTCTCTAGCCTCGATTGGTCCAGCCACGCTTTAC
GTAAATGATGTTCACCACATAGAACAATCCGGCCGTTATGAAGAGAAAGGCAGCCTCTTCTTCACCTACGGAAGC
GAGGAAAAGGTCGCGTTCATGGACTTTGAAGGAGGAAGAGATTATGATCTTCGAATTGATTATAAATCTCATAAT
CGTCAATTCGATCCAGATCTCCTGCCCTTGTTGGATCCCATGGAAAATCAATTCCAGGGCATTCGCCTCGGCTTC
GAGGAAGCAGATGCCTCAGACCGACCAGCGGATGCGGCCAGACTTGCTAGAGGCTGCGACGCGGCTGTTGTTGTC
GTGGGTCGCGATAGGGAGTGGGAGACTGAAGGCCAGGATATCCTCTCCTTTGATCTACCTGGTGAGCAACTGCAT
CTGATACGTGCTGTCGCAGCGGTATGCCCCCGGACTATTGTCCTGATACAGGCAGGGACTCCAGTAAACATGGAG
CCGTGGGTGCATGAGGTGTCCGCTGTCCTTTACACTTGGTATCAAGGCCAAGAATTGGGCAACGCCACAGTTGAT
GTTTTGTTTGGCCGTGTGAATCCGTCGGGGCGACTGCCGGTAACCTTTCCACTACGCATCGAGGACTGCCCTGCG
TTTTCTTCCTTCCCAGGAGAAGAAAACCAAGTGCAGTACACTGAAGGCCTTTTCGTGGGCTATCGGTGGTGGGAT
CTTCTGTCCATCAAGCCCCTCTTCCCCCTTGGCTTTGGTCTCTCCTATAACAAATTTACCGTCTCCCCTGGTTCC
ATCAGCGCACGCGAGCTTATCAATGAACCTTCAACTCCGTTAAAGGTAACGGCCCATGTAGTCAACACAGGTGGC
AGTGAGCTTCCAGGGCGGGAGACGGTAATTGTGTGGTTCTCACCGTCCAGTCCAACACGCCTTCAGCGCCCCAAA
AAGCAAATCTGTGGGTTTATGAAGTCGCGCCAATTGCTCCCTGGTGAAACCGACGAGGTGGAGATTGAACTTGAT
TTCCATTCCTTTGTGCTCTGCAAAATCGCATCAATGGAAGAAGTCAAGAAACCTGAGGACAATGTACAGATTAAC
ATTAATCTCGACAGCTCAACCCATGATGATAACCTTCCTGTCGCTACAATCCCGTTCAAGGAACAGTTGAAGCTG
GTCATGCAATACAAGCGTGCTGTCTGGGCTGCCCTCGCGTGCTCGACAACCACCATCCTGATTGGATATGATCTG
GCCTTGATTGGTTCGATCATCGCCAACACCGAATTCATCAAGCAGTTTGGCGTGTATGACCCTGCATCGCAGGCC
TGGTCACTCCCCGCAAACCAACAGCTTGTGTGGTCTATTATCCAGTATGTCTCTGCTATGGCAGCTGCTATCGTG
TCTGGCTTGGTGAATGATATTTTCGGGCGTCGAATATGCTTCCTATTGACCGTCTCACTCACCATCACCGGGACG
TTTGTGGAGCTATTTTCTACAGAATGGAAAACTTGGGTAGTGGCCAAGTTCTTCATGGGTGCAGCTATGGGATCC
ATGCAGGCGAACACGCAAACTTTTGTATCAGAAATCACCCCGACAGCCATCCGTGGCCTGACTCTGTCCCTCTTC
CAGTTCTGGATTATAGTCGGCCAGCTTATTGCATCATGTGTCCTAGAGGGAACAAGCCATGTCAGCAGCTCATGG
TCCTGGCGAGGGGCTGTCGCGTCCCAGTTTGGACCTGCCCTGTTTTGTCTAGTCATGTTCTTCATCTTTGTCCCT
GAATCACCATACTACCTCGTCTCCCGGGACCGCCTCGAGGACGCTAAAGCAGCACTTGCCCGCCTCCGAGCAGCC
GAGATTGACAGCACCACCCTCGATATTGAAGTCAGCCAAATCCAAGCAACTTTGCTCCACGAGCGCCAGTCCCGT
GCCATCGGTTCCTCGTACCTCGAATGTTTTCAGGGCATCAACCTCCGCCGCACCCTCCTCGCCTGCCTCCCCGTG
ATCATGCAAATCCTTACAGGCTTCCCACTCTGTGGCAACTATCTTTCTTATTTCCTCACCCTGTCTGGCTTTGAA
AACGCTTTCCTGATCACGGTCATTCAAGTGATTGTCGCACTATTTGCTGCGCTGTGGGCATTTTCTCTTGTCGAG
CGCGTCGGTCGACGGCCCCAAATGCTCGTCGGATCATCTGGCATGCTTCTCTGCCTCCTCGTTATTTCAATTCTT
GGGTTCGTGGGCGCTGGGGAAGGTTGGAACTACAGTGCCCTCGCAGCTTTCTGCATCATTTGGGCCCTGTTCTAC
TACTCATCCGTCGGCGCAGTCGGGTGGGCTATCGTTGGCGAAATCTCATCCCCCCGGTTGCGGGCCAAGACAACC
TCGATCGTAGCCTTCACTGTTTCACTAATCAACATGGCCTGGTCCATCGCGATCCCGTATCTTGTGAACAAGGAG
GATGCTAACCTGGGCGCCAAGACGGGATTGATCTTCCTGGGCACTGGACTCGCTTGTGCAATTGTTTGTTTTTTC
TGTTTGCCGGAGACCAAAGGGCGGTCATTTGATATGTTGGACGCATTGTTTGAGATGAAAACATCAGCGAGGAGG
TTCTGA
Transcript >Ani_SJS38_1|g1880.t1
ATGTCTACACTCGATACAGACACGCTTCTCTCACACTTGACACTCGAGGAAAAATGTCAGTTAATCGCAGGCCAG
TCTCAATGGCGGACCGCCACAATTGAGCGCCTTGGTATTCCCGCCCTTAAGGTGTCAGATGGCCCCTCCGGAGTG
CGCGGAGAAATTTTTGGAGAGAACGTCCCGGCTGCGTTTCTACCTTGTGGCGTGAGTCTTGGAGCTACATGGGAT
CAGGATCTCCTATACGAGGTAGCGCAGCTGCTCGGGGACGAGTGCAAATCTAAATCCGCCTCGGCTTTGCTTGCC
CCGACAATCTGTCTTCATCGTCACCCTCTCGGTGGCCGGAATTTTGAAGCCTTTAGCGAGGACCCTTTCCTCACG
GGCAAACTGGCTGTTGCTTATGTTCGCGGAATCCAATCGTGTGGCATTGGCGCGACGCCAAAGCATTTTGCAGCA
AATGACCAGGAGACCAAGAGGTTCAAATACAATGTCAATGTTGCGGCCCGAGCTCTGCGTGAAGTCTACCTCTTG
CCGTTCCAGATGGTGGTCCGCGACGCGGACCCCTGGTTTATGATGACTGCCTATAATCAGTTGAATGGGCATTAC
TGCGACGCAAACAAAGAGCTACTCATTGACATCGCGCGGGGCGAATGGGGTTGGGATGGAGTCTTCATGAGTGAC
TGGGGCGGCACGACCTCAACAGTGAAGTCAATCAACAATGGCCTTGATCTGGAAATGCCCGGTCCGCCCTCCAAA
CGCTCAAAAGAGGCCCTTGAACAGCCAATTAAAGACGGGCTCATTGATTTGGATCGCATCAACGAGTCCGCGGGT
CGTATCCTACGCCTTCTCAAGAAAGCTGGTCGCTTTGATGCTCCGAGAGATGGACCCGAGAGATGTGATGACACC
CCTGAAAAGAGGGCCCTGCTCCTTCGAGCAGCAGCTGCGGGGATCGTTATGCTAAAAAACGAGAATAATGCTCTG
CCTCTCAAGCCGACAGTGAATATTTCCAAGCTTGGTGTATTCGGCCCTAACGCGAAGAGGGTAGTTGCTGGTGGA
GGTGGAAGCTCATATATCAAGGCTCCCTATTGGACTTCTGTGCACGACTCAATCTGCTCCGAGCTCCACGCCTTT
GGTACTGAGATCGTCTTTGCAGAGGGGGCTCGAGTTAACCGATACCTCCCCCTTTGCAAGATAGCGAGGGATCCA
GATACCGGCAAGGTAGGTGCGGCGGTGGACTGGTTCAATGGGCACGACCTCACAGGTGGCCCTGTAGTGACCACC
CACATTGACGATTTGTATTACATGTCCTTCGGCACCGTGCCATCCGAAATTGGTGACGTCTTCTCGTTCCGCGTC
CGAGCCACGATAAAGCCGCTTACATCGGGATATCATGCATTCTCTCTAGCCTCGATTGGTCCAGCCACGCTTTAC
GTAAATGATGTTCACCACATAGAACAATCCGGCCGTTATGAAGAGAAAGGCAGCCTCTTCTTCACCTACGGAAGC
GAGGAAAAGGTCGCGTTCATGGACTTTGAAGGAGGAAGAGATTATGATCTTCGAATTGATTATAAATCTCATAAT
CGTCAATTCGATCCAGATCTCCTGCCCTTGTTGGATCCCATGGAAAATCAATTCCAGGGCATTCGCCTCGGCTTC
GAGGAAGCAGATGCCTCAGACCGACCAGCGGATGCGGCCAGACTTGCTAGAGGCTGCGACGCGGCTGTTGTTGTC
GTGGGTCGCGATAGGGAGTGGGAGACTGAAGGCCAGGATATCCTCTCCTTTGATCTACCTGGTGAGCAACTGCAT
CTGATACGTGCTGTCGCAGCGGTATGCCCCCGGACTATTGTCCTGATACAGGCAGGGACTCCAGTAAACATGGAG
CCGTGGGTGCATGAGGTGTCCGCTGTCCTTTACACTTGGTATCAAGGCCAAGAATTGGGCAACGCCACAGTTGAT
GTTTTGTTTGGCCGTGTGAATCCGTCGGGGCGACTGCCGGTAACCTTTCCACTACGCATCGAGGACTGCCCTGCG
TTTTCTTCCTTCCCAGGAGAAGAAAACCAAGTGCAGTACACTGAAGGCCTTTTCGTGGGCTATCGGTGGTGGGAT
CTTCTGTCCATCAAGCCCCTCTTCCCCCTTGGCTTTGGTCTCTCCTATAACAAATTTACCGTCTCCCCTGGTTCC
ATCAGCGCACGCGAGCTTATCAATGAACCTTCAACTCCGTTAAAGGTAACGGCCCATGTAGTCAACACAGGTGGC
AGTGAGCTTCCAGGGCGGGAGACGGTAATTGTGTGGTTCTCACCGTCCAGTCCAACACGCCTTCAGCGCCCCAAA
AAGCAAATCTGTGGGTTTATGAAGTCGCGCCAATTGCTCCCTGGTGAAACCGACGAGGTGGAGATTGAACTTGAT
TTCCATTCCTTTGTGCTCTGCAAAATCGCATCAATGGAAGAAGTCAAGAAACCTGAGGACAATGTACAGATTAAC
ATTAATCTCGACAGCTCAACCCATGATGATAACCTTCCTGTCGCTACAATCCCGTTCAAGGAACAGTTGAAGCTG
GTCATGCAATACAAGCGTGCTGTCTGGGCTGCCCTCGCGTGCTCGACAACCACCATCCTGATTGGATATGATCTG
GCCTTGATTGGTTCGATCATCGCCAACACCGAATTCATCAAGCAGTTTGGCGTGTATGACCCTGCATCGCAGGCC
TGGTCACTCCCCGCAAACCAACAGCTTGTGTGGTCTATTATCCAGTATGTCTCTGCTATGGCAGCTGCTATCGTG
TCTGGCTTGGTGAATGATATTTTCGGGCGTCGAATATGCTTCCTATTGACCGTCTCACTCACCATCACCGGGACG
TTTGTGGAGCTATTTTCTACAGAATGGAAAACTTGGGTAGTGGCCAAGTTCTTCATGGGTGCAGCTATGGGATCC
ATGCAGGCGAACACGCAAACTTTTGTATCAGAAATCACCCCGACAGCCATCCGTGGCCTGACTCTGTCCCTCTTC
CAGTTCTGGATTATAGTCGGCCAGCTTATTGCATCATGTGTCCTAGAGGGAACAAGCCATGTCAGCAGCTCATGG
TCCTGGCGAGGGGCTGTCGCGTCCCAGTTTGGACCTGCCCTGTTTTGTCTAGTCATGTTCTTCATCTTTGTCCCT
GAATCACCATACTACCTCGTCTCCCGGGACCGCCTCGAGGACGCTAAAGCAGCACTTGCCCGCCTCCGAGCAGCC
GAGATTGACAGCACCACCCTCGATATTGAAGTCAGCCAAATCCAAGCAACTTTGCTCCACGAGCGCCAGTCCCGT
GCCATCGGTTCCTCGTACCTCGAATGTTTTCAGGGCATCAACCTCCGCCGCACCCTCCTCGCCTGCCTCCCCGTG
ATCATGCAAATCCTTACAGGCTTCCCACTCTGTGGCAACTATCTTTCTTATTTCCTCACCCTGTCTGGCTTTGAA
AACGCTTTCCTGATCACGGTCATTCAAGTGATTGTCGCACTATTTGCTGCGCTGTGGGCATTTTCTCTTGTCGAG
CGCGTCGGTCGACGGCCCCAAATGCTCGTCGGATCATCTGGCATGCTTCTCTGCCTCCTCGTTATTTCAATTCTT
GGGTTCGTGGGCGCTGGGGAAGGTTGGAACTACAGTGCCCTCGCAGCTTTCTGCATCATTTGGGCCCTGTTCTAC
TACTCATCCGTCGGCGCAGTCGGGTGGGCTATCGTTGGCGAAATCTCATCCCCCCGGTTGCGGGCCAAGACAACC
TCGATCGTAGCCTTCACTGTTTCACTAATCAACATGGCCTGGTCCATCGCGATCCCGTATCTTGTGAACAAGGAG
GATGCTAACCTGGGCGCCAAGACGGGATTGATCTTCCTGGGCACTGGACTCGCTTGTGCAATTGTTTGTTTTTTC
TGTTTGCCGGAGACCAAAGGGCGGTCATTTGATATGTTGGACGCATTGTTTGAGATGAAAACATCAGCGAGGAGG
TTCTGA
Gene >Ani_SJS38_1|g1880.t1
ATGTCTACACTCGATACAGACACGCTTCTCTCACACTTGACACTCGAGGAAAAATGTCAGTTAATCGCAGGCCAG
TCTCAATGGCGGACCGCCACAATTGAGCGCCTTGGTATTCCCGCCCTTAAGGTAATAGCCATATCCCGAACGCAC
CTCATAACTTCTAATTAATCTGTTATATCAGGTGTCAGATGGCCCCTCCGGAGTGCGCGGAGAAATTTTTGGAGA
GAACGTCCCGGCTGCGTTTCTACCTTGTGGCGTGAGTCTTGGAGCTACATGGGATCAGGATCTCCTATACGAGGT
AGCGCAGCTGCTCGGGGACGAGGTGAATAATTCTTTCTACTGATAAACGCAGCGCTGTTCTGTACTGATTCATAC
CAGTGCAAATCTAAATCCGCCTCGGCTTTGCTTGCCCCGACAATCTGTCTTCATCGTCACCCTCTCGGTGGCCGG
AATTTTGAAGCCTTTAGCGAGGACCCTTTCCTCACGGGCAAACTGGCTGTTGCTTATGTTCGCGGAATCCAATCG
TGTGGCATTGGCGCGACGCCAAAGCATTTTGCAGGTACGTTTCTCTCCATTCCACCCCCTTATCACTAACTGAGA
CTGACTAAACATAGCAAATGACCAGGAGACCAAGAGGTTCAAATACAATGTCAATGTTGCGGCCCGAGCTCTGCG
TGAAGTCTACCTCTTGCCGTTCCAGATGGTGGTCCGCGACGCGGACCCCTGGTTTATGATGACTGCCTATAATCA
GTTGAATGGGCATTACTGCGACGCAAACAAAGAGCTACTCATTGACATCGCGCGGGGCGAATGGGGTTGGGATGG
AGTCTTCATGAGTGACTGGGGCGGCACGACCTCAACAGTGAAGTCAATCAACAATGGCCTTGATCTGGAAATGCC
CGGTCCGCCCTCCAAACGCTCAAAAGAGGCCCTTGAACAGCCAATTAAAGACGGGCTCATTGATTTGGATCGCAT
CAACGAGTCCGCGGGTCGTATCCTACGCCTTCTCAAGAAAGCTGGTCGCTTTGATGCTCCGAGAGATGGACCCGA
GAGATGTGATGACACCCCTGAAAAGAGGGCCCTGCTCCTTCGAGCAGCAGCTGCGGGGATCGTTATGCTAAAAAA
CGAGAATAATGCTCTGCCTCTCAAGCCGACAGTGAATATTTCCAAGCTTGGTGTATTCGGCCCTAACGCGAAGAG
GGTAGTTGCTGGTGGAGGTGGAAGCTCATATATCAAGGCTCCCTATTGGACTTCTGTGCACGACTCAATCTGCTC
CGAGCTCCACGCCTTTGGTACTGAGATCGTCTTTGCAGAGGGGGCTCGAGTTAACCGATACCTCCCCCTTTGCAA
GATAGCGAGGGATCCAGATACCGGCAAGGTAGGTGCGGCGGTGGACTGGTTCAATGGGCACGACCTCACAGGTGG
CCCTGTAGTGACCACCCACATGTGAGTAAAGTTGACTATTCCTTCCCTTCACGTATTTGACTGACAGCTTCGATA
AAGTGACGATTTGTATTACATGTCCTTCGGCACCGTGCCATCCGAAATTGGTGACGTCTTCTCGTTCCGCGTCCG
AGCCACGATAAAGCCGCTTACATCGGGATATCATGCATTCTCTCTAGCCTCGATTGGTCCAGCCACGCTTTACGT
AAATGATGTTCACCACATAGAACAATCCGGCCGTTATGAAGAGAAAGGCAGCCTCTTCTTCACCTACGGAAGCGA
GGAAAAGGTCGCGTTCATGGACTTTGAAGGAGGAAGAGATTATGATCTTCGAATTGATTATAAATCTCATAATCG
TCAATTCGATCCAGATCTCCTGCCCTTGTTGGATCCCATGGAAAATCAATTCCAGGGCATTCGCCTCGGCTTCGA
GGAAGCAGATGCCTCAGACCGACCAGCGGATGCGGCCAGACTTGCTAGAGGCTGCGACGCGGCTGTTGTTGTCGT
GGGTCGCGATAGGGAGTGGGAGACTGAAGGCCAGGATATCCTCTCCTTTGATCTACCTGGTGAGCAACTGCATCT
GATACGTGCTGTCGCAGCGGTATGCCCCCGGACTATTGTCCTGATACAGGCAGGGACTCCAGTAAACATGGAGCC
GTGGGTGCATGAGGTGTCCGCTGTCCTTTACACTTGGTATCAAGGCCAAGAATTGGGCAACGCCACAGTTGATGT
TTTGTTTGGCCGTGTGAATCCGTCGGGGCGACTGCCGGTAACCTTTCCACTACGCATCGAGGACTGCCCTGCGTT
TTCTTCCTTCCCAGGAGAAGAAAACCAAGTGCAGTACACTGAAGGCCTTTTCGTGGGCTATCGGTGGTGGGATCT
TCTGTCCATCAAGCCCCTCTTCCCCCTTGGCTTTGGTCTCTCCTATAACAAATTTACCGTCTCCCCTGGTTCCAT
CAGCGCACGCGAGCTTATCAATGAACCTTCAACTCCGTTAAAGGTAACGGCCCATGTAGTCAACACAGGTGGCAG
TGAGCTTCCAGGGCGGGAGACGGTAATTGTGTGGTTCTCACCGTCCAGTCCAACACGCCTTCAGCGCCCCAAAAA
GCAAATCTGTGGGTTTATGAAGTCGCGCCAATTGCTCCCTGGTGAAACCGACGAGGTGGAGATTGAACTTGATTT
CCATTCCTTTGGTATGTTTGAGGCGTCGAGACACTCCTGGATTATCGATGCCGATTCCGAGTTTGAGATTCTGCT
AGGAACAACGGCGGCGAATGCGGTGCCTGCTTGGAAAGTGACGGTTCCTCGTGAGATTACTTGGATCAAATAAAA
TTAGACCGAATGGAAATTGCCTAGTTCACTTTCACGGCTCGTTAAATAATTCGTAAGGGCGGTCATGCTCGTGTA
GTATTCAAATCTCACTTTAGTCCACTGGGTGCGCTCTGAGCGTCGAGTTTAGATCAGAGGAGAATGATGTCGAGA
TAGTTAGTTCATGTACTAGTCTTCAGCGACTAGAAAGCAATCAGCATCGACGTCTTTGAGGTGAATCTGGATACG
GCCGATCTCGGAGCTAAGTGTGATAACACTGGAATCAATAATTGGTCGTAGTTTGATTCCTGCGTTAGAGGAGAA
GGCCCGGCGACAGGGGAAGAAGGGGGGGGGGGGGGGAGGCAAAATTTGAATTCTAGGTTTATGGAAGGCTTCGGC
GCTCGCCCTCGTGACCGCCAGAGGCCTCAGACTCGGCTGCTGTGCAAGCTGGCCTGGGGTTCCGGGGTTACCCTA
ATGAGCGGAAGGTGAATTCCGCTCCGCAAACCTTAAGGACGATACTCTATCAGGCAATCCATGGGCTATTCTTCG
CTGCTCAGGAGCCTATATAGGAATGGGCCATGCGCTACTTGTCTCTAATCCAATTCACCCTCCTCGTTCCATCAG
TTCATCATCAGTCCTGTACTACCTCCTGATTTTTCTTCTTATCTGGCCCTCCTTAGTGCTCTGCAAAATCGCATC
AATGGAAGAAGTCAAGAAACCTGAGGACAATGTACAGATTAACATTAATCTCGACAGCTCAACCCATGATGATAA
CCTTCCTGTCGCTACAATCCCGTTCAAGGAACAGTTGAAGCTGGTCATGCAATACAAGCGTGCTGTCTGGGCTGG
TGAGTGTTTGCATTACGATTCATCTCCACGGGATCTAACTGTTACGGAAAAGCCCTCGCGTGCTCGACAACCACC
ATCCTGATTGGATATGATCTGGCCTTGATTGGTTCGATCATCGCCAACACCGAATTCATCAAGCAGTTTGGCGTG
TATGACCCTGCATCGCAGGCCTGGTCACTCCCCGCAAACCAACAGCTTGTGTGGTCTATTATCCAGTATGTCTCT
GCTATGGCAGCTGCTATCGTGTCTGGCTTGGTGAATGATATTTTCGGGCGTCGAATATGCTTCCTATTGACCGTC
TCGTGAGTCAATTAAGCCATTTCTTGCGGTGCTCAACCCTCGGGGTAACTGACATCTCCTTGCTCCCTCACAGAC
TCACCATCACCGGGACGTTTGTGGAGCTATTTTCTACAGAATGGAAAACTTGGGTAGTGGCCAAGTTCTTCATGG
GTGCAGCTATGGGATCCATGCAGGCGAACACGCAAACTTTTGTATCAGAAATCACCCCGACAGCCATCCGTGGCC
TGACTCTGTCCCTCTTCCAGTTCTGGATTATAGTCGGCCAGCTTATTGCATCATGTGTCCTAGAGGGAACAAGCC
ATGTCAGCAGCTCATGGTCCTGGCGAGGGGCTGTCGCGTCCCAGTTTGGACCTGCCCTGTTTTGTCTAGTCATGT
TCTTCATCTTTGTCCCTGAATCACCATACTACCTCGTCTCCCGGGACCGCCTCGAGGACGCTAAAGCAGCACTTG
CCCGCCTCCGAGCAGCCGAGATTGACAGCACCACCCTCGATATTGAAGTCAGCCAAATCCAAGCAACTTTGCTCC
ACGAGCGCCAGTCCCGTGCCATCGGTTCCTCGTACCTCGAATGTTTTCAGGGCATCAACCTCCGCCGCACCCTCC
TCGCCTGCCTCCCCGTGATCATGCAAATCCTTACAGGCTTCCCACTCTGTGGCAACTATCTTTCTTATTTCCTCA
CCCTGTCTGGCTTTGAAAACGCTTTCCTGATCACGGTCATTCAAGTGATTGTCGCACTATTTGCTGCGCTGTGGG
CATTTTCTCTTGTCGAGCGCGTCGGTCGACGGCCCCAAATGCTCGTCGGATCATCTGGCATGCTTCTCTGCCTCC
TCGTTATTTCAATTCTTGGGTTCGTGGGCGCTGGGGAAGGTTGGAACTACAGTGCCCTCGCAGCTTTCTGCATCA
TTTGGGCCCTGTTCTACTACTCATCCGTCGGCGCAGTCGGGTGGGCTATCGTTGGCGAAATCTCATCCCCCCGGT
TGCGGGCCAAGACAACCTCGATCGTAGCCTTCACTGTTTCACTAATCAACATGGCCTGGTCCATCGCGATCCCGT
ATCTTGTGAACAAGGAGGATGCTAACCTGGGCGCCAAGACGGGATTGATCTTCCTGGGCACTGGACTCGCTTGTG
CAATTGTTTGTTTTTTCTGTTTGCCGGAGACCAAAGGGCGGTCATTTGATATGTTGGACGCATTGTTTGAGATGA
AAACATCAGCGAGGAGGTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail