Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS35_1|g1756.t1
Gene name
Locationscaffold_007:391034..392084
Strand-
Gene length (bp)1050
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 3.8E-22 180 326

GO

GO Term Description Terminal node
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0008150 biological_process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 64 81 17
2 85 107 22
3 170 192 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup11148
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g320.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g5621.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g394.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g1046.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g82.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g3297.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g1756.t1 (this protein)
Aspergillus niger CBS 147345 Ani_SJS72_1|g5693.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g662.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g2116.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g1935.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS35_1|g1756.t1
MSGTHPNPKDSMKSTWRRLDRAEWTIYHWFYEILGVHPEHLDKEVPVHQKTEKIPYMRTWSQHVWILYHAFIPLA
VHHVYVSYTGQNFTPVGAFFFYSIAFKLIAIHQLQVMRRMGHVLGFLDGDQHGRDGVPDVGVAKVVRSLISTSTF
RPIMTVFLSYRVSQAPAQMSWGWLPLEIGLYGIILDFWFYWYHRLMHDVGSLWKYHRTHHLTKHPNPLLTLYADT
EQEFFDIAGIPLMTYFSMRLMGMPMGFYEWWICHQYVVFTELAGHSGLRMHASPPSTLDWLLRLIGAELVIEDHD
LHHRKGWKKSHNYGKQTRLWDKIFGTCHERIESREGNVDYDNTVRMPIF*
Coding >Ani_SJS35_1|g1756.t1
ATGAGCGGTACACACCCTAATCCCAAGGATTCGATGAAGTCCACCTGGCGCCGGCTGGATCGCGCCGAGTGGACC
ATCTATCACTGGTTCTACGAGATCCTCGGTGTGCACCCCGAACACCTTGACAAGGAGGTCCCCGTGCACCAAAAG
ACCGAGAAGATCCCCTACATGAGAACATGGTCCCAGCATGTTTGGATCCTCTACCACGCCTTCATCCCCCTCGCC
GTCCACCACGTCTACGTCTCGTACACAGGCCAGAATTTTACCCCCGTGGGCGCCTTCTTCTTCTACTCCATCGCC
TTCAAGCTCATCGCCATCCACCAACTCCAAGTCATGCGCCGCATGGGCCACGTTCTCGGCTTCCTAGACGGCGAC
CAGCACGGCCGTGACGGCGTCCCGGACGTCGGGGTAGCCAAGGTCGTCCGGTCCCTGATATCGACATCAACCTTC
CGACCCATCATGACCGTCTTCCTCAGTTACCGAGTCAGTCAAGCACCGGCACAGATGAGCTGGGGATGGCTACCG
CTCGAGATCGGGCTATACGGAATCATCCTCGACTTCTGGTTCTACTGGTACCATCGACTGATGCACGACGTGGGC
AGTCTCTGGAAATATCACCGGACGCATCATCTTACCAAACACCCCAACCCGCTTCTCACCCTGTATGCGGACACG
GAGCAGGAGTTCTTCGATATCGCAGGCATCCCGCTGATGACGTACTTCAGTATGCGGCTGATGGGGATGCCGATG
GGGTTCTATGAGTGGTGGATCTGTCATCAGTATGTGGTGTTCACGGAGTTGGCGGGCCATAGTGGATTGAGGATG
CATGCGTCGCCGCCGTCAACGCTGGATTGGTTGTTGAGGTTGATTGGGGCGGAGTTGGTGATTGAGGATCATGAC
TTGCATCATCGGAAGGGGTGGAAGAAGAGTCATAATTATGGGAAGCAGACTAGGCTGTGGGATAAGATCTTTGGA
ACGTGCCATGAGCGAATTGAGAGTCGGGAGGGAAATGTGGATTATGATAATACGGTTAGGATGCCGATCTTTTAG
Transcript >Ani_SJS35_1|g1756.t1
ATGAGCGGTACACACCCTAATCCCAAGGATTCGATGAAGTCCACCTGGCGCCGGCTGGATCGCGCCGAGTGGACC
ATCTATCACTGGTTCTACGAGATCCTCGGTGTGCACCCCGAACACCTTGACAAGGAGGTCCCCGTGCACCAAAAG
ACCGAGAAGATCCCCTACATGAGAACATGGTCCCAGCATGTTTGGATCCTCTACCACGCCTTCATCCCCCTCGCC
GTCCACCACGTCTACGTCTCGTACACAGGCCAGAATTTTACCCCCGTGGGCGCCTTCTTCTTCTACTCCATCGCC
TTCAAGCTCATCGCCATCCACCAACTCCAAGTCATGCGCCGCATGGGCCACGTTCTCGGCTTCCTAGACGGCGAC
CAGCACGGCCGTGACGGCGTCCCGGACGTCGGGGTAGCCAAGGTCGTCCGGTCCCTGATATCGACATCAACCTTC
CGACCCATCATGACCGTCTTCCTCAGTTACCGAGTCAGTCAAGCACCGGCACAGATGAGCTGGGGATGGCTACCG
CTCGAGATCGGGCTATACGGAATCATCCTCGACTTCTGGTTCTACTGGTACCATCGACTGATGCACGACGTGGGC
AGTCTCTGGAAATATCACCGGACGCATCATCTTACCAAACACCCCAACCCGCTTCTCACCCTGTATGCGGACACG
GAGCAGGAGTTCTTCGATATCGCAGGCATCCCGCTGATGACGTACTTCAGTATGCGGCTGATGGGGATGCCGATG
GGGTTCTATGAGTGGTGGATCTGTCATCAGTATGTGGTGTTCACGGAGTTGGCGGGCCATAGTGGATTGAGGATG
CATGCGTCGCCGCCGTCAACGCTGGATTGGTTGTTGAGGTTGATTGGGGCGGAGTTGGTGATTGAGGATCATGAC
TTGCATCATCGGAAGGGGTGGAAGAAGAGTCATAATTATGGGAAGCAGACTAGGCTGTGGGATAAGATCTTTGGA
ACGTGCCATGAGCGAATTGAGAGTCGGGAGGGAAATGTGGATTATGATAATACGGTTAGGATGCCGATCTTTTAG
Gene >Ani_SJS35_1|g1756.t1
ATGAGCGGTACACACCCTAATCCCAAGGATTCGATGAAGTCCACCTGGCGCCGGCTGGATCGCGCCGAGTGGACC
ATCTATCACTGGTTCTACGAGATCCTCGGTGTGCACCCCGAACACCTTGACAAGGAGGTCCCCGTGCACCAAAAG
ACCGAGAAGATCCCCTACATGAGAACATGGTCCCAGCATGTTTGGATCCTCTACCACGCCTTCATCCCCCTCGCC
GTCCACCACGTCTACGTCTCGTACACAGGCCAGAATTTTACCCCCGTGGGCGCCTTCTTCTTCTACTCCATCGCC
TTCAAGCTCATCGCCATCCACCAACTCCAAGTCATGCGCCGCATGGGCCACGTTCTCGGCTTCCTAGACGGCGAC
CAGCACGGCCGTGACGGCGTCCCGGACGTCGGGGTAGCCAAGGTCGTCCGGTCCCTGATATCGACATCAACCTTC
CGACCCATCATGACCGTCTTCCTCAGTTACCGAGTCAGTCAAGCACCGGCACAGATGAGCTGGGGATGGCTACCG
CTCGAGATCGGGCTATACGGAATCATCCTCGACTTCTGGTTCTACTGGTACCATCGACTGATGCACGACGTGGGC
AGTCTCTGGAAATATCACCGGACGCATCATCTTACCAAACACCCCAACCCGCTTCTCACCCTGTATGCGGACACG
GAGCAGGAGTTCTTCGATATCGCAGGCATCCCGCTGATGACGTACTTCAGTATGCGGCTGATGGGGATGCCGATG
GGGTTCTATGAGTGGTGGATCTGTCATCAGTATGTGGTGTTCACGGAGTTGGCGGGCCATAGTGGATTGAGGATG
CATGCGTCGCCGCCGTCAACGCTGGATTGGTTGTTGAGGTTGATTGGGGCGGAGTTGGTGATTGAGGATCATGAC
TTGCATCATCGGAAGGGGTGGAAGAAGAGTCATAATTATGGGAAGCAGACTAGGCTGTGGGATAAGATCTTTGGA
ACGTGCCATGAGCGAATTGAGAGTCGGGAGGGAAATGTGGATTATGATAATACGGTTAGGATGCCGATCTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail