Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS30_1|g518.t1
Gene name
Locationscaffold_002:667114..668726
Strand+
Gene length (bp)1612
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-28 35 390

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 69 91 22
3 120 142 22
4 155 177 22
5 189 211 22
6 262 284 22
7 297 314 17
8 324 341 17
9 348 370 22
10 380 402 22
11 415 437 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup8492
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g1688.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g9561.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g3222.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g1925.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g7492.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g790.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g5495.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g1398.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g8001.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g518.t1 (this protein)
Aspergillus niger CBS 147322 Ani_SJS35_1|g642.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g5028.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g1729.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g318.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g1975.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g1369.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g2954.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g4389.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g1146.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g8314.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g1556.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g6919.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g5050.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g5192.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS30_1|g518.t1
MAFTTRLATWLWGHDPKDRALLAKLDVTLLPYFSLIWFLFGVTRSSYSSAYISGMKEALGFKGKEYNYMSTAYLV
VYAVCQMPGTSLLTVVRPKYVFVTANVTWSVLTLITYKMTRAWQVILLNAIEGGFSAIAYVGAQFILASWYKKSE
LGMRAAVFCVFGQLGTLSGGWIQAGLLETLAGKGGLPAWKWIFIIVSVMTLPVALFGWVFIPDLPSHRAAWYLTD
EQKEHAATRLGTLSKKSWDITVFKRVLLSWQFWLLPFVFMLYSVCVQMLGNNVMAYWLASRGYTVVQQNTYPTVI
HATAVVGIVVYAAISDKLQSRWEVSIAIGLTFVIGSAILVSTPSTDAGYFVAFYLLGTTYAPQAVWYSWMADVTG
HDLQLRAITTGFMNSFDFAFVTWWPLVFYPVTDSPNFRKGYIASLVTGMLTLPVIGLIAYLEKRDTARGIIGRTR
TDSLLEEEPVLSPDDETGKPGSPPITVRATEDGV*
Coding >Ani_SJS30_1|g518.t1
ATGGCCTTCACAACCAGACTTGCGACCTGGCTTTGGGGTCACGATCCGAAGGATCGGGCTCTGCTTGCCAAGCTG
GATGTGACTCTGCTCCCTTATTTTTCCCTAATTTGGTTCCTTTTCGGTGTGACACGGTCTAGCTATTCCTCGGCC
TACATCAGCGGCATGAAAGAGGCTCTCGGGTTCAAGGGGAAAGAGTACAATTACATGAGCACCGCATACCTGGTC
GTCTATGCCGTCTGCCAAATGCCCGGTACAAGCCTTCTCACAGTGGTGCGACCGAAATATGTCTTTGTTACTGCC
AATGTTACTTGGAGTGTCTTGACCTTGATCACGTACAAGATGACACGGGCCTGGCAGGTCATTCTGTTAAATGCG
ATCGAAGGAGGGTTCTCAGCTATCGCATACGTTGGCGCACAATTCATCCTAGCGTCGTGGTACAAAAAGTCGGAG
CTCGGGATGCGGGCAGCGGTATTCTGCGTGTTCGGCCAATTGGGGACGCTGTCCGGTGGCTGGATTCAAGCCGGT
CTGCTAGAGACACTCGCTGGTAAAGGTGGCCTACCCGCATGGAAGTGGATATTCATCATCGTCTCAGTGATGACT
CTTCCGGTGGCACTCTTCGGCTGGGTCTTCATTCCGGACCTTCCATCACATCGTGCAGCCTGGTATCTTACCGAT
GAACAGAAGGAACATGCGGCAACTCGACTGGGTACCCTTTCCAAGAAGTCCTGGGACATCACAGTCTTCAAGCGC
GTCTTGCTGAGCTGGCAATTCTGGCTCCTGCCGTTTGTTTTCATGTTGTATTCAGTTTGTGTGCAAATGCTAGGG
AACAACGTCATGGCCTACTGGCTAGCCTCACGGGGGTACACGGTCGTCCAGCAGAACACCTATCCTACCGTCATC
CATGCCACTGCCGTTGTGGGGATAGTTGTGTATGCCGCAATTTCAGACAAGTTACAATCGCGATGGGAGGTCTCT
ATCGCCATTGGTCTAACTTTTGTCATCGGCTCAGCTATCCTTGTATCGACCCCTTCCACGGACGCTGGCTACTTT
GTTGCCTTCTACTTGCTCGGAACGACATACGCGCCTCAGGCTGTCTGGTATTCCTGGATGGCCGACGTTACAGGC
CATGACCTCCAGCTGCGTGCCATCACAACTGGATTTATGAACTCCTTTGACTTTGCTTTTGTGACCTGGTGGCCG
TTGGTCTTCTATCCAGTAACCGATTCGCCCAACTTCAGAAAAGGGTATATTGCGAGCTTAGTGACGGGGATGTTA
ACTCTCCCAGTTATCGGTCTTATCGCTTACCTCGAAAAAAGGGACACCGCCAGAGGAATCATTGGAAGAACTCGT
ACTGATAGTTTGCTCGAAGAAGAGCCGGTTCTTTCCCCAGATGATGAAACGGGAAAGCCTGGAAGCCCTCCGATA
ACCGTGCGCGCCACTGAGGACGGTGTGTAG
Transcript >Ani_SJS30_1|g518.t1
ATGGCCTTCACAACCAGACTTGCGACCTGGCTTTGGGGTCACGATCCGAAGGATCGGGCTCTGCTTGCCAAGCTG
GATGTGACTCTGCTCCCTTATTTTTCCCTAATTTGGTTCCTTTTCGGTGTGACACGGTCTAGCTATTCCTCGGCC
TACATCAGCGGCATGAAAGAGGCTCTCGGGTTCAAGGGGAAAGAGTACAATTACATGAGCACCGCATACCTGGTC
GTCTATGCCGTCTGCCAAATGCCCGGTACAAGCCTTCTCACAGTGGTGCGACCGAAATATGTCTTTGTTACTGCC
AATGTTACTTGGAGTGTCTTGACCTTGATCACGTACAAGATGACACGGGCCTGGCAGGTCATTCTGTTAAATGCG
ATCGAAGGAGGGTTCTCAGCTATCGCATACGTTGGCGCACAATTCATCCTAGCGTCGTGGTACAAAAAGTCGGAG
CTCGGGATGCGGGCAGCGGTATTCTGCGTGTTCGGCCAATTGGGGACGCTGTCCGGTGGCTGGATTCAAGCCGGT
CTGCTAGAGACACTCGCTGGTAAAGGTGGCCTACCCGCATGGAAGTGGATATTCATCATCGTCTCAGTGATGACT
CTTCCGGTGGCACTCTTCGGCTGGGTCTTCATTCCGGACCTTCCATCACATCGTGCAGCCTGGTATCTTACCGAT
GAACAGAAGGAACATGCGGCAACTCGACTGGGTACCCTTTCCAAGAAGTCCTGGGACATCACAGTCTTCAAGCGC
GTCTTGCTGAGCTGGCAATTCTGGCTCCTGCCGTTTGTTTTCATGTTGTATTCAGTTTGTGTGCAAATGCTAGGG
AACAACGTCATGGCCTACTGGCTAGCCTCACGGGGGTACACGGTCGTCCAGCAGAACACCTATCCTACCGTCATC
CATGCCACTGCCGTTGTGGGGATAGTTGTGTATGCCGCAATTTCAGACAAGTTACAATCGCGATGGGAGGTCTCT
ATCGCCATTGGTCTAACTTTTGTCATCGGCTCAGCTATCCTTGTATCGACCCCTTCCACGGACGCTGGCTACTTT
GTTGCCTTCTACTTGCTCGGAACGACATACGCGCCTCAGGCTGTCTGGTATTCCTGGATGGCCGACGTTACAGGC
CATGACCTCCAGCTGCGTGCCATCACAACTGGATTTATGAACTCCTTTGACTTTGCTTTTGTGACCTGGTGGCCG
TTGGTCTTCTATCCAGTAACCGATTCGCCCAACTTCAGAAAAGGGTATATTGCGAGCTTAGTGACGGGGATGTTA
ACTCTCCCAGTTATCGGTCTTATCGCTTACCTCGAAAAAAGGGACACCGCCAGAGGAATCATTGGAAGAACTCGT
ACTGATAGTTTGCTCGAAGAAGAGCCGGTTCTTTCCCCAGATGATGAAACGGGAAAGCCTGGAAGCCCTCCGATA
ACCGTGCGCGCCACTGAGGACGGTGTGTAG
Gene >Ani_SJS30_1|g518.t1
ATGGCCTTCACAACCAGACTTGCGACCTGGCTTTGGGGTCACGATCCGAAGGATCGGGCTCTGCTTGCCAAGCTG
GATGTGACTCTGCTCCCTTATTTTTCCCTAATTTGGTTCCTTTTCGGTGTGACACGGTCTAGCTATTCCTCGGCC
TACATCAGCGGCATGAAAGAGGCTCTCGGGTTCAAGGGGAAAGAGTACAATTACATGAGCACCGCATACCTGGTC
GTCTATGCCGTCTGCCAAATGCCCGGTACAAGCCTTCTCACAGTGGTGCGACCGAAATATGTCTTTGTTACTGCC
AATGTTACTTGGAGTGTCTTGACCTTGATCACGTACAAGATGACACGGGCCTGGCAGGTCATTCTGTTAAATGCG
ATCGAAGGAGGGTTCTCAGCTATCGCATAGTAATTGCCTAATCTACTTTGCACGTGAAACTGTTCTGACCGGTAC
TAATTTTGAATAGCGTTGGCGCACAATTCATCCTAGCGTCGTGGTACAAAAAGTCGGAGCTCGGGATGCGGGCAG
CGGTATTCTGCGTGTTCGGCCAATTGGGGACGCTGTCCGGTGGCTGGATTCAAGCCGGTCTGCTAGAGACACTCG
CTGGTAAAGGTGGCCTACCCGCATGGAAGTGGATATTCATCATCGTCTCAGTGATGACTCTTCCGGTGGCACTCT
TCGGTATGGCTTGTACTCTGTCCCAGTGGGAAAATGCTGACAATTTCGTAGGCTGGGTCTTCATTCCGGACCTTC
CATCACATCGTGCAGCCTGGTATCTTACCGATGAACAGAAGGAACATGCGGCAACTCGACTGGGTACCCTTTCCA
AGAAGTCCTGGGACATCACAGTCTTCAAGCGCGTCTTGCTGAGCTGGCAATTCTGGCTCCTGCCGTTTGTTTTCA
TGTGTAGGTCGAGAGAGTTTTGTCTTCGAGTCACCGAGCTAATATCCAATCAGTGTATTCAGTTTGTGTGCAAAT
GCTAGGGAACAACGTCATGGCCTACTGGCTAGCCTCACGGGGGTACACGGTCGTCCAGCAGAACACCTATCCTAC
CGTCATCCATGCCACTGCCGTTGTGGGGATAGTTGTGTATGCCGCAATTTCAGACAAGTTACAATCGCGATGGGA
GGTCTCTATCGCCATTGGTCTAACTTTTGTCATCGGCTCAGCTATCCTTGTATCGACCCCTTCCACGGACGCTGG
CTACTTTGTTGCCTTCTACTTGCTCGGAACGACATACGCGCCTCAGGCTGTCTGGTATTCCTGGATGGCCGACGT
TACAGGCCATGACCTCCAGCTGCGTGCCATCACAACTGGATTTATGAACTCCTTTGACTTTGCTTTTGTGACCTG
GTGGCCGTTGGTCTTCTATCCAGTAACCGATTCGCCCAACTTCAGAAAAGGGTATATTGCGAGCTTAGTGACGGG
GATGTTAACTCTCCCAGTTATCGGTCTTATCGCTTACCTCGAAAAAAGGGACACCGCCAGAGGAATCATTGGAAG
AACTCGTACTGATAGTTTGCTCGAAGAAGAGCCGGTTCTTTCCCCAGATGATGAAACGGGAAAGCCTGGAAGCCC
TCCGATAACCGTGCGCGCCACTGAGGACGGTGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail