Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS30_1|g5124.t1
Gene name
Locationscaffold_033:131041..132926
Strand+
Gene length (bp)1885
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6 3.7E-112 131 425
PF00734 CBM_1 Fungal cellulose binding domain 2.1E-12 22 50

GO

GO Term Description Terminal node
GO:0030248 cellulose binding Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0030245 cellulose catabolic process Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0006073 cellular glucan metabolic process No
GO:0009987 cellular process No
GO:0005976 polysaccharide metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0030243 cellulose metabolic process No
GO:0008152 metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0000272 polysaccharide catabolic process No
GO:0030247 polysaccharide binding No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044262 cellular carbohydrate metabolic process No
GO:0009251 glucan catabolic process No
GO:0009056 catabolic process No
GO:0044247 cellular polysaccharide catabolic process No
GO:0005488 binding No
GO:0044042 glucan metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044275 cellular carbohydrate catabolic process No
GO:0044238 primary metabolic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0030246 carbohydrate binding No
GO:0051275 beta-glucan catabolic process No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0044248 cellular catabolic process No
GO:0016787 hydrolase activity No
GO:0051273 beta-glucan metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.99976

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH6 4.6E-97 128 420

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup10178
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g11005.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g2003.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g10832.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g4379.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g10742.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g6699.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g10154.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g4575.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g9647.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g5124.t1 (this protein)
Aspergillus niger CBS 147322 Ani_SJS35_1|g6400.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g4253.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g1573.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g6633.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g5105.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g2618.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g404.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g1782.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g4622.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g8734.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g10847.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g4302.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g10050.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS30_1|g5124.t1
MHYTLSLAFAFLPFGIQAQQTLWGQCGGQGYSGATSCVAGATCATVNEYYAQCTPAAGTGSATTLKTTTSSTTAA
VTKTTTTLSPTGSASPTTTASASGNPFSGYQLYVNPYYSSEVASLAIPSLTGSLSSLQAAATAAAKVPSFVWLDT
AAKVPTMGDYLADIKSQNAAGANPPIAGQFVVYDLPDRDCAALASNGEYSIADDGVEHYKSYIDSIREILVQYSD
VHTLLVIEPDSLANLVTNLNVAKCANAESAYLECTNYALTQLNLPNVAMYLDAGHAGWLGWPANQQPAANLFASV
YKNASSPAAVRGLATNVANYNAWTISSCPSYTQGNSVCDEQQYINAIAPLLQAQGFDAHFVVDTGRNGKQPTGQQ
AWGDWCNVINTGFGERPTTNTGDALVDAFVWVKPGGESDGTSDSSATRYDAHCGYSDALQPAPEAGTWFQAYFVQ
LLTNANPAF*
Coding >Ani_SJS30_1|g5124.t1
ATGCACTATACATTGTCTCTCGCATTTGCATTTCTGCCATTCGGAATCCAGGCTCAGCAAACCCTTTGGGGACAA
TGTGGTGGTCAGGGATATTCAGGAGCCACCAGTTGTGTGGCTGGTGCAACATGCGCAACTGTGAATGAATACTAT
GCTCAGTGTACGCCAGCGGCAGGCACGGGCTCAGCCACTACCTTGAAGACAACTACTAGTAGTACCACTGCTGCA
GTGACGAAGACTACCACTACTCTAAGCCCTACCGGCTCTGCCTCGCCGACTACTACGGCCAGCGCTAGCGGCAAC
CCGTTCAGTGGGTACCAGCTCTATGTGAACCCATACTACTCATCGGAAGTCGCGTCTCTGGCCATTCCATCTCTC
ACTGGTTCTCTCTCCTCGCTCCAGGCGGCGGCAACCGCCGCAGCCAAGGTGCCTTCTTTCGTGTGGCTGGATACT
GCCGCCAAAGTTCCTACCATGGGCGACTACCTGGCGGACATCAAATCCCAGAATGCTGCTGGAGCGAACCCTCCA
ATCGCCGGCCAATTTGTGGTATACGACCTCCCCGACCGCGACTGCGCCGCGCTCGCCAGCAACGGCGAGTATTCG
ATCGCGGACGACGGGGTTGAACACTACAAGTCCTACATTGATTCCATCCGCGAGATTCTTGTGCAGTATTCGGAT
GTTCATACCCTTCTGGTGATTGAGCCCGACAGTCTCGCCAACCTGGTGACAAACCTCAATGTGGCCAAATGTGCC
AATGCTGAAAGTGCATACCTTGAATGTACGAATTATGCGTTAACTCAGCTCAACCTTCCCAACGTGGCCATGTAT
CTTGACGCCGGACACGCCGGCTGGCTCGGCTGGCCCGCAAATCAGCAACCCGCCGCCAACCTGTTTGCGAGCGTC
TACAAAAATGCCAGTTCCCCCGCTGCGGTGCGCGGCCTGGCCACCAACGTTGCTAACTACAACGCCTGGACCATT
TCTTCCTGCCCCTCCTACACCCAGGGGAACAGCGTCTGCGACGAGCAACAGTACATCAATGCGATTGCCCCGCTG
CTACAGGCACAGGGCTTCGACGCCCACTTTGTCGTCGATACCGGTCGCAATGGCAAACAGCCCACGGGCCAACAG
GCCTGGGGTGACTGGTGCAATGTCATTAACACAGGCTTTGGCGAGCGCCCGACCACCAACACCGGCGATGCGCTC
GTCGACGCCTTTGTCTGGGTGAAGCCGGGGGGCGAGAGCGATGGCACCTCCGATAGCTCGGCCACTCGATACGAT
GCCCACTGTGGGTATAGCGATGCCTTGCAGCCGGCGCCTGAGGCGGGAACTTGGTTCCAGGCCTACTTCGTGCAG
CTGCTCACCAACGCCAATCCAGCTTTCTAG
Transcript >Ani_SJS30_1|g5124.t1
ATGCACTATACATTGTCTCTCGCATTTGCATTTCTGCCATTCGGAATCCAGGCTCAGCAAACCCTTTGGGGACAA
TGTGGTGGTCAGGGATATTCAGGAGCCACCAGTTGTGTGGCTGGTGCAACATGCGCAACTGTGAATGAATACTAT
GCTCAGTGTACGCCAGCGGCAGGCACGGGCTCAGCCACTACCTTGAAGACAACTACTAGTAGTACCACTGCTGCA
GTGACGAAGACTACCACTACTCTAAGCCCTACCGGCTCTGCCTCGCCGACTACTACGGCCAGCGCTAGCGGCAAC
CCGTTCAGTGGGTACCAGCTCTATGTGAACCCATACTACTCATCGGAAGTCGCGTCTCTGGCCATTCCATCTCTC
ACTGGTTCTCTCTCCTCGCTCCAGGCGGCGGCAACCGCCGCAGCCAAGGTGCCTTCTTTCGTGTGGCTGGATACT
GCCGCCAAAGTTCCTACCATGGGCGACTACCTGGCGGACATCAAATCCCAGAATGCTGCTGGAGCGAACCCTCCA
ATCGCCGGCCAATTTGTGGTATACGACCTCCCCGACCGCGACTGCGCCGCGCTCGCCAGCAACGGCGAGTATTCG
ATCGCGGACGACGGGGTTGAACACTACAAGTCCTACATTGATTCCATCCGCGAGATTCTTGTGCAGTATTCGGAT
GTTCATACCCTTCTGGTGATTGAGCCCGACAGTCTCGCCAACCTGGTGACAAACCTCAATGTGGCCAAATGTGCC
AATGCTGAAAGTGCATACCTTGAATGTACGAATTATGCGTTAACTCAGCTCAACCTTCCCAACGTGGCCATGTAT
CTTGACGCCGGACACGCCGGCTGGCTCGGCTGGCCCGCAAATCAGCAACCCGCCGCCAACCTGTTTGCGAGCGTC
TACAAAAATGCCAGTTCCCCCGCTGCGGTGCGCGGCCTGGCCACCAACGTTGCTAACTACAACGCCTGGACCATT
TCTTCCTGCCCCTCCTACACCCAGGGGAACAGCGTCTGCGACGAGCAACAGTACATCAATGCGATTGCCCCGCTG
CTACAGGCACAGGGCTTCGACGCCCACTTTGTCGTCGATACCGGTCGCAATGGCAAACAGCCCACGGGCCAACAG
GCCTGGGGTGACTGGTGCAATGTCATTAACACAGGCTTTGGCGAGCGCCCGACCACCAACACCGGCGATGCGCTC
GTCGACGCCTTTGTCTGGGTGAAGCCGGGGGGCGAGAGCGATGGCACCTCCGATAGCTCGGCCACTCGATACGAT
GCCCACTGTGGGTATAGCGATGCCTTGCAGCCGGCGCCTGAGGCGGGAACTTGGTTCCAGGCCTACTTCGTGCAG
CTGCTCACCAACGCCAATCCAGCTTTCTAG
Gene >Ani_SJS30_1|g5124.t1
ATGCACTATACATTGTCTCTCGCATTTGCATTTCTGCCATTCGGAATCCAGGCTCAGCAAACCCTTTGGGGACAA
TGTGGTGGTCAGGGATATTCAGGAGCCACCAGTTGTGTGGCTGGTGCAACATGCGCAACTGTGAATGAATGTAAG
GGTTCTTTCTGGGGATTTTGCTGATCGATAGCTGAGTGACCATGGCCATTAGACTATGCTCAGTGTACGCCAGCG
GCAGGCACGGGCTCAGCCACTACCTTGAAGACAACTACTAGTAGTACCACTGCTGCAGTGACGAAGACTACCACT
ACTCTAAGCCCTACCGGCTCTGCCTCGCCGACTACTACGGCCAGCGCTAGCGGCAACCCGTTCAGTGGGTACCAG
CTCTATGTGAACCCATACTACTCATCGGAAGTCGCGTCTCTGGCCATTCCATCTCTCACTGGTTCTCTCTCCTCG
CTCCAGGCGGCGGCAACCGCCGCAGCCAAGGTGCCTTCTTTCGTGTGGCTGTATGCTCCCTCATTCTACAATGTA
ATTTATAATAGCCTCTTGTTGACATTTGCCAGGGATACTGCCGCCAAAGTTCCTACCATGGGCGACTACCTGGCG
GACATCAAATCCCAGAATGCTGCTGGAGCGAACCCTCCAATCGCCGGCCAATTTGTGGTATACGACCTCCCCGAC
CGCGACTGCGCCGCGCTCGCCAGCAACGGCGAGTATTCGATCGCGGACGACGGGGTTGAACACTACAAGTCCTAC
ATTGATTCCATCCGCGAGATTCTTGTGCAGTATTCGGATGTTCATACCCTTCTGGTGATTGGTGAGTGTCTTCCC
ACTTAGTTTGGACATAGTCTACTGCATCTGAACGCTAAATGTCACCTCCCCCAACAGAGCCCGACAGTCTCGCCA
ACCTGGTGACAAACCTCAATGTGGCCAAATGTGCCAATGCTGAAAGTGCATACCTTGAATGTACGAATTATGCGT
TAACTCAGCTCAACCTTCCCAACGTGGCCATGTATCTTGACGCCGGTAAGCTGCGCATCCATCATATCTACTTAC
TCTTCAAGTATCCACGGGGAGAGACCGCCGAGGCACCCTTTGCACTCAGCTTCCCTGGCAAATTTCCCCTTTACA
TACCCAGCCCAGTCGAAGATCCCTCCTCCCTCCGATTAAACCTTCATGACAAAATCTGACCAAAGAACTTTAGGA
CACGCCGGCTGGCTCGGCTGGCCCGCAAATCAGCAACCCGCCGCCAACCTGTTTGCGAGCGTCTACAAAAATGCC
AGTTCCCCCGCTGCGGTGCGCGGCCTGGCCACCAACGTTGCTAACTACAACGCCTGGACCATTTCTTCCTGCCCC
TCCTACACCCAGGGGAACAGCGTCTGCGACGAGCAACAGTACATCAATGCGATTGCCCCGCTGCTACAGGCACAG
GGCTTCGACGCCCACTTTGTCGTCGATACCGGTATGCGCAATTCTGCAACCCCCAGTAACCCTACGCCCTGCCTC
TGGCTAACATGTATCGCTAACTTCCAGGTCGCAATGGCAAACAGCCCACGGGCCAACAGGCCTGGGGTGACTGGT
GCAATGTCATTAACACAGGCTTTGGCGAGCGCCCGACCACCAACACCGGCGATGCGCTCGTCGACGCCTTTGTCT
GGGTGAAGCCGGGGGGCGAGAGCGATGGCACCTCCGATAGCTCGGCCACTCGATACGATGCCCACTGTGGGTATA
GCGATGCCTTGCAGCCGGCGCCTGAGGCGGGAACTTGGTTCCAGGTATGTTTACCGATCAAGCTCGTTGGCTGAG
AATGAATTGGATGATGGGACTGACGTGATTGTGCTCGTAGGCCTACTTCGTGCAGCTGCTCACCAACGCCAATCC
AGCTTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail