Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS28_1|g3174.t1
Gene name
Locationscaffold_015:198701..203775
Strand+
Gene length (bp)5074
Transcript length (bp)4881
Coding sequence length (bp)4881
Protein length (aa) 1627

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18325 Fas_alpha_ACP Fatty acid synthase subunit alpha Acyl carrier domain 6.8E-56 149 312
PF18314 FAS_I_H Fatty acid synthase type I helical domain 1.4E-43 341 529
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 8.4E-22 1071 1280
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 9.6E-10 1415 1504

GO

GO Term Description Terminal node
GO:0008897 holo-[acyl-carrier-protein] synthase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 14 PKS-like

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup1272
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g4869.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g2451.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g2903.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g6850.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g8123.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g2445.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g8947.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g6440.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g3174.t1 (this protein)
Aspergillus niger CBS 147321 Ani_SJS30_1|g10938.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g4253.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g10229.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g9207.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g4819.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g2189.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g8785.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g3539.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g6719.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g3933.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g11072.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g2816.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g6697.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g6553.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g6210.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS28_1|g3174.t1
MAPKEKMHPRVQRELAYVLLTELLAYQFASPVRWIETQDVVLQEQKVDRLVEIGPAETLLGMIKKTLGAKYQVHD
AALAIQREIWSHKKNAREIYYELNDAEIVPTQTGKEASTPAAQPSQPTPITLPEAAETATPKPVPVRQSPSSIED
TPIAALDIIVALIAHKLKKPLQDIDLSQTIKKLVGGRSTLENEIVGDLGAEFGSIPDAPEDTPLSELSQSIEAQG
SWKKGLGKTTQTIVNRMVSAKMPAGLGSGEVRAHLLNKYGIQTGRQDAVLLRAAVQQPAARLPDTSAAHAFLEDI
VQQYAQYAKIDLSAIGASSDGAGTSSGPVVVDQTAVKALTKTQDDRAQAMLELYAKLLGVDLQAGHKASNKAAEI
IAELQDELQLWISEHGEVYGSGIRPMLSVAKARRYDSFWNWALQDTVDLFHRILAGTITLTGREVETIMGRIARK
SNSKLVQMLEYLETQCLKLRNPRAVHARDVLHQLRLACNPQLSDAQPLAAHRLMIDAPKTAIDSQGKIHYMEVPR
ATVDAAPPATLKSLGSQGWETRADLTAAFMATLRQTEHECLSFSDAEVLVIGAGRDSIGTEIVRGLLRGGARVLV
TTSSYSLTTTRLYQQIYAEEGARGSQLVLLPFNQASQQDLESLVSYIYDSDKGLGWDLSHVVPFAAIPEGGRQIE
DIDSKSELAHRIMLTNTIRLLGAIKKQKQARGFDSHPAQVILPLSPNHGIFGGDGLYPESKIALETLFNRWSSES
WGTYLSICGAVIGWTRGTGLMSANNGVAEDIEKMGVRTFSQVEMAYYILVLMSSPIATECEVTPVQADLSGGMGH
FPNFKETVDSIRQKQKETSEIRDALAKEEAFERAALGQPSEEEPQVREQKAKLALEFPRLPDYQTELLPLAGQLR
GMVDLDRVVVVTGFSEVGPHGNARTRWEMEAFGEFSLEGCIEMAWIMGLIKHHNGPLNGNPHYHGWIVAATKEPI
RDIDVKKRFEEHILAHTGIRLIEPEINDGYDPYKKKFLQEVVLDEDMPPFKTSKETAEQLRLEHGDKVDVIPEGE
EYTVRLLKGACLMIPKALRFDRAVAGQIPTGWDARTYGLTEDLASQVDPATLYALIGTVEALLSAGISDPFEIYQ
YLHVSEIGNCIGSGLGGVKALRKLHKDRFVEKQVQNDILQESFINTTAAWINMLLLSSTGPIRTPVGACATSIES
LESGYETIVSGKAKMCLVGGFDDFSEDVSYEFAKMKATVSSEAEFEKGRDPSEMSRPAASTRAGFVESQGSGIQV
ITSAQLALDMGLPIQGIVAWVGTASDKIGRSVPAPGKGLLTNAREARHRAPSPMLDISYRRRRLNMSLQHIKERV
DMEVDIAEAELTDLKRSPSPYAEERIEEINERLRYVRREARVQEKDALNTFGNHFWKNNPEISPLRGALATWNLT
INDLDVVSFHGTSTVLNEKNETNMISQQLHHLGRTKGNPALGIFQKYLTGHSKGAAGAWMLNGGLQVLNTGLVPG
NRNADNIDAALQNDYLVYPSRSIQTTGVKAFSVTSFGFGQKGAQALGVHARYLFATLDQETYDAYRVRVEARQRR
AQQQFRFGIAHNAVFSAKEAPPYRNDQEFRILLDPEARLTENARGQMEYAE*
Coding >Ani_SJS28_1|g3174.t1
ATGGCACCCAAGGAGAAGATGCATCCCCGGGTCCAGCGGGAGCTGGCGTACGTGTTGTTGACTGAACTTCTTGCG
TACCAGTTTGCTTCACCGGTCAGGTGGATTGAAACACAAGACGTCGTGCTCCAGGAACAAAAGGTTGATCGGCTG
GTCGAGATTGGACCTGCTGAGACTTTGCTTGGCATGATAAAGAAGACATTGGGAGCAAAGTACCAAGTCCATGAT
GCTGCACTTGCCATCCAACGAGAGATCTGGAGTCATAAGAAGAATGCACGAGAGATATACTATGAATTGAACGAT
GCCGAGATCGTACCAACCCAAACAGGCAAGGAGGCATCCACGCCCGCTGCACAGCCCTCACAGCCCACCCCTATC
ACACTCCCGGAGGCAGCTGAGACCGCCACGCCCAAGCCAGTACCAGTGCGGCAATCCCCTTCCAGCATTGAAGAC
ACCCCGATAGCAGCACTCGACATTATCGTCGCCCTGATCGCACACAAACTGAAGAAGCCGTTGCAAGACATTGAC
TTGAGCCAAACCATCAAGAAGCTGGTCGGAGGCCGATCCACCCTAGAGAATGAGATCGTCGGAGACCTCGGCGCC
GAGTTTGGCTCCATTCCAGACGCCCCCGAAGATACTCCCCTGTCGGAGCTCTCTCAATCCATCGAGGCTCAAGGT
TCATGGAAGAAAGGCCTGGGCAAGACCACACAGACCATTGTCAACCGAATGGTGTCGGCAAAAATGCCTGCGGGT
CTGGGGTCAGGCGAAGTACGAGCTCACCTGCTTAACAAATATGGCATACAGACAGGCCGCCAGGATGCGGTTCTG
CTGCGCGCCGCGGTGCAGCAGCCCGCTGCAAGACTCCCAGATACTAGCGCTGCTCATGCTTTTCTTGAAGACATC
GTCCAACAGTACGCTCAATATGCGAAGATTGATCTGTCTGCTATAGGAGCTTCGTCTGATGGGGCTGGCACATCA
TCTGGGCCAGTTGTGGTAGACCAGACTGCCGTCAAGGCACTGACTAAGACTCAGGACGACCGGGCCCAAGCCATG
CTGGAGTTGTATGCAAAGTTGCTTGGGGTAGACCTGCAGGCTGGACACAAGGCCAGCAACAAAGCAGCAGAAATT
ATAGCAGAGCTACAGGACGAGCTGCAGCTCTGGATTTCGGAGCATGGTGAGGTTTACGGTTCGGGCATCAGGCCT
ATGCTATCCGTGGCCAAAGCCCGCAGGTACGACTCGTTTTGGAATTGGGCGCTACAAGACACTGTGGACCTGTTT
CACCGGATCCTGGCCGGGACCATTACGCTAACTGGCCGCGAGGTGGAAACCATCATGGGCCGTATTGCTCGGAAG
TCCAATTCAAAACTCGTGCAGATGCTAGAATACCTGGAGACACAGTGCCTGAAGCTTCGAAACCCGCGAGCGGTT
CATGCCCGCGATGTCCTCCATCAATTGCGGCTGGCATGCAACCCGCAGTTATCAGATGCTCAGCCATTGGCTGCG
CACCGGTTGATGATAGACGCACCGAAGACAGCCATTGACAGCCAAGGAAAAATTCATTATATGGAGGTTCCTCGT
GCCACCGTCGATGCCGCACCACCGGCTACCCTCAAATCACTGGGGAGCCAGGGTTGGGAAACCCGAGCGGACTTG
ACTGCAGCCTTCATGGCGACTCTTCGCCAAACGGAACACGAGTGTCTTTCGTTCTCAGACGCAGAGGTGCTTGTC
ATTGGTGCGGGACGGGATTCTATCGGCACCGAAATTGTCCGCGGCCTTCTGAGAGGAGGTGCTCGGGTACTCGTA
ACGACCAGTAGTTACTCGCTCACGACAACACGACTGTATCAACAAATCTATGCCGAAGAAGGGGCTCGTGGATCG
CAGCTCGTTCTCCTGCCCTTCAACCAAGCGAGTCAGCAAGACCTTGAGTCCCTGGTGTCTTACATCTATGATTCC
GACAAAGGGCTCGGATGGGATTTGAGCCATGTTGTCCCATTTGCAGCCATTCCAGAAGGTGGCCGGCAAATTGAG
GACATCGACTCTAAGTCAGAGTTGGCCCATCGTATCATGCTGACAAACACGATCAGGTTGCTAGGAGCAATCAAG
AAGCAGAAGCAGGCACGAGGATTCGACAGTCACCCTGCACAGGTAATCCTGCCATTGTCGCCGAACCACGGCATT
TTTGGTGGAGATGGCCTGTACCCCGAGTCGAAGATTGCTCTCGAAACACTATTCAACCGCTGGAGCTCCGAGTCA
TGGGGTACATATCTTTCAATCTGCGGTGCTGTTATCGGCTGGACGCGCGGAACCGGACTCATGAGCGCGAATAAT
GGTGTCGCGGAAGATATTGAGAAGATGGGAGTGAGGACGTTCTCCCAGGTCGAAATGGCCTACTACATCCTTGTC
CTTATGTCATCTCCAATTGCAACCGAATGCGAGGTGACACCAGTGCAGGCAGACCTAAGCGGTGGCATGGGTCAC
TTCCCGAATTTCAAAGAGACGGTTGATTCCATCCGGCAGAAACAGAAGGAAACCAGTGAAATCCGAGACGCCTTG
GCAAAGGAGGAAGCCTTTGAGCGCGCTGCCCTTGGACAGCCATCGGAAGAAGAACCGCAGGTACGGGAACAAAAG
GCCAAGCTTGCGCTCGAGTTTCCTCGTCTACCTGACTACCAGACCGAGCTTCTTCCTCTCGCCGGTCAGTTGCGC
GGAATGGTTGATCTCGACCGCGTGGTCGTCGTCACCGGTTTCTCTGAAGTCGGGCCACACGGCAACGCCCGGACA
CGCTGGGAGATGGAGGCATTCGGGGAGTTCTCGCTAGAGGGCTGCATTGAGATGGCTTGGATCATGGGTCTGATC
AAGCATCACAATGGACCTCTCAACGGGAATCCGCATTACCATGGTTGGATCGTTGCAGCGACCAAGGAGCCTATT
CGCGATATCGATGTAAAGAAGCGGTTCGAAGAGCACATCCTGGCACACACCGGCATTCGACTCATTGAGCCAGAG
ATCAACGATGGCTACGATCCTTACAAGAAGAAATTCTTGCAGGAAGTGGTTCTCGACGAGGACATGCCTCCGTTT
AAGACGTCCAAGGAGACCGCAGAGCAACTCCGACTGGAGCACGGCGATAAGGTTGATGTCATCCCCGAAGGCGAA
GAGTACACCGTCCGCCTACTCAAGGGAGCTTGCCTGATGATCCCAAAGGCCCTTCGATTCGACCGGGCAGTGGCT
GGCCAGATTCCGACCGGCTGGGATGCCCGTACTTACGGGCTTACCGAGGATCTCGCCAGTCAAGTGGATCCAGCC
ACATTATATGCTCTCATTGGAACGGTGGAAGCACTTTTGAGTGCAGGAATCAGTGACCCATTCGAGATATACCAG
TATTTGCATGTGTCGGAAATCGGCAATTGCATTGGCTCTGGCTTGGGAGGCGTCAAGGCACTCCGAAAGCTGCAT
AAGGACCGCTTCGTGGAGAAGCAGGTTCAGAACGACATTTTGCAGGAATCATTCATCAACACCACGGCTGCATGG
ATTAACATGCTCTTGCTGTCCTCCACCGGCCCTATCCGAACCCCGGTCGGCGCTTGCGCCACCTCGATTGAGTCG
CTCGAATCCGGCTACGAGACTATCGTCTCCGGCAAAGCCAAGATGTGCCTTGTTGGTGGCTTCGACGACTTCTCC
GAGGATGTGTCGTATGAGTTCGCGAAGATGAAGGCCACGGTTAGTAGCGAGGCAGAGTTTGAAAAAGGTCGTGAT
CCCAGCGAGATGTCGCGACCGGCTGCTTCCACCCGTGCTGGATTCGTCGAGTCTCAAGGCAGTGGTATCCAGGTG
ATCACATCCGCCCAGCTGGCATTGGACATGGGCCTTCCCATCCAGGGCATCGTCGCATGGGTCGGAACTGCTAGT
GACAAGATTGGGCGTTCTGTTCCTGCTCCCGGAAAGGGTCTCTTGACGAATGCACGCGAGGCACGACACCGAGCC
CCGTCCCCCATGTTGGATATTTCTTACCGGCGTCGGAGACTGAATATGTCGCTCCAGCACATCAAGGAACGCGTC
GACATGGAGGTGGACATTGCTGAGGCAGAACTGACCGACCTCAAGCGCAGCCCTAGCCCCTACGCGGAAGAACGC
ATTGAAGAGATCAACGAACGCCTCCGCTACGTACGCCGGGAAGCCCGGGTCCAAGAGAAGGATGCGTTGAACACG
TTTGGTAATCATTTCTGGAAGAATAACCCGGAGATTTCTCCGCTACGCGGTGCTCTAGCAACTTGGAACCTGACT
ATCAACGACCTGGATGTGGTCTCGTTCCACGGGACATCCACCGTGTTGAACGAGAAGAACGAGACGAACATGATT
AGCCAACAGCTGCATCATCTGGGTCGGACGAAGGGTAATCCTGCATTAGGAATCTTCCAGAAGTATCTTACTGGA
CACTCAAAGGGTGCTGCAGGAGCGTGGATGCTCAATGGTGGCCTACAAGTGCTCAACACCGGCTTGGTTCCAGGC
AACCGCAATGCAGACAACATCGACGCAGCCCTGCAGAACGACTATTTAGTCTACCCCAGTCGCAGCATACAGACT
ACAGGTGTCAAGGCCTTTTCGGTAACATCTTTCGGGTTCGGACAGAAAGGAGCGCAAGCCTTGGGTGTTCATGCC
CGCTATCTCTTCGCCACGCTGGACCAGGAGACCTATGACGCGTATCGGGTCCGAGTTGAAGCAAGACAGCGCCGG
GCGCAGCAGCAATTCCGGTTTGGCATTGCACACAATGCTGTCTTTTCTGCTAAAGAGGCACCGCCATACCGGAAT
GATCAAGAGTTCCGCATTCTGCTGGATCCGGAGGCGCGTTTGACCGAGAATGCCCGGGGGCAGATGGAATATGCG
GAGTAA
Transcript >Ani_SJS28_1|g3174.t1
ATGGCACCCAAGGAGAAGATGCATCCCCGGGTCCAGCGGGAGCTGGCGTACGTGTTGTTGACTGAACTTCTTGCG
TACCAGTTTGCTTCACCGGTCAGGTGGATTGAAACACAAGACGTCGTGCTCCAGGAACAAAAGGTTGATCGGCTG
GTCGAGATTGGACCTGCTGAGACTTTGCTTGGCATGATAAAGAAGACATTGGGAGCAAAGTACCAAGTCCATGAT
GCTGCACTTGCCATCCAACGAGAGATCTGGAGTCATAAGAAGAATGCACGAGAGATATACTATGAATTGAACGAT
GCCGAGATCGTACCAACCCAAACAGGCAAGGAGGCATCCACGCCCGCTGCACAGCCCTCACAGCCCACCCCTATC
ACACTCCCGGAGGCAGCTGAGACCGCCACGCCCAAGCCAGTACCAGTGCGGCAATCCCCTTCCAGCATTGAAGAC
ACCCCGATAGCAGCACTCGACATTATCGTCGCCCTGATCGCACACAAACTGAAGAAGCCGTTGCAAGACATTGAC
TTGAGCCAAACCATCAAGAAGCTGGTCGGAGGCCGATCCACCCTAGAGAATGAGATCGTCGGAGACCTCGGCGCC
GAGTTTGGCTCCATTCCAGACGCCCCCGAAGATACTCCCCTGTCGGAGCTCTCTCAATCCATCGAGGCTCAAGGT
TCATGGAAGAAAGGCCTGGGCAAGACCACACAGACCATTGTCAACCGAATGGTGTCGGCAAAAATGCCTGCGGGT
CTGGGGTCAGGCGAAGTACGAGCTCACCTGCTTAACAAATATGGCATACAGACAGGCCGCCAGGATGCGGTTCTG
CTGCGCGCCGCGGTGCAGCAGCCCGCTGCAAGACTCCCAGATACTAGCGCTGCTCATGCTTTTCTTGAAGACATC
GTCCAACAGTACGCTCAATATGCGAAGATTGATCTGTCTGCTATAGGAGCTTCGTCTGATGGGGCTGGCACATCA
TCTGGGCCAGTTGTGGTAGACCAGACTGCCGTCAAGGCACTGACTAAGACTCAGGACGACCGGGCCCAAGCCATG
CTGGAGTTGTATGCAAAGTTGCTTGGGGTAGACCTGCAGGCTGGACACAAGGCCAGCAACAAAGCAGCAGAAATT
ATAGCAGAGCTACAGGACGAGCTGCAGCTCTGGATTTCGGAGCATGGTGAGGTTTACGGTTCGGGCATCAGGCCT
ATGCTATCCGTGGCCAAAGCCCGCAGGTACGACTCGTTTTGGAATTGGGCGCTACAAGACACTGTGGACCTGTTT
CACCGGATCCTGGCCGGGACCATTACGCTAACTGGCCGCGAGGTGGAAACCATCATGGGCCGTATTGCTCGGAAG
TCCAATTCAAAACTCGTGCAGATGCTAGAATACCTGGAGACACAGTGCCTGAAGCTTCGAAACCCGCGAGCGGTT
CATGCCCGCGATGTCCTCCATCAATTGCGGCTGGCATGCAACCCGCAGTTATCAGATGCTCAGCCATTGGCTGCG
CACCGGTTGATGATAGACGCACCGAAGACAGCCATTGACAGCCAAGGAAAAATTCATTATATGGAGGTTCCTCGT
GCCACCGTCGATGCCGCACCACCGGCTACCCTCAAATCACTGGGGAGCCAGGGTTGGGAAACCCGAGCGGACTTG
ACTGCAGCCTTCATGGCGACTCTTCGCCAAACGGAACACGAGTGTCTTTCGTTCTCAGACGCAGAGGTGCTTGTC
ATTGGTGCGGGACGGGATTCTATCGGCACCGAAATTGTCCGCGGCCTTCTGAGAGGAGGTGCTCGGGTACTCGTA
ACGACCAGTAGTTACTCGCTCACGACAACACGACTGTATCAACAAATCTATGCCGAAGAAGGGGCTCGTGGATCG
CAGCTCGTTCTCCTGCCCTTCAACCAAGCGAGTCAGCAAGACCTTGAGTCCCTGGTGTCTTACATCTATGATTCC
GACAAAGGGCTCGGATGGGATTTGAGCCATGTTGTCCCATTTGCAGCCATTCCAGAAGGTGGCCGGCAAATTGAG
GACATCGACTCTAAGTCAGAGTTGGCCCATCGTATCATGCTGACAAACACGATCAGGTTGCTAGGAGCAATCAAG
AAGCAGAAGCAGGCACGAGGATTCGACAGTCACCCTGCACAGGTAATCCTGCCATTGTCGCCGAACCACGGCATT
TTTGGTGGAGATGGCCTGTACCCCGAGTCGAAGATTGCTCTCGAAACACTATTCAACCGCTGGAGCTCCGAGTCA
TGGGGTACATATCTTTCAATCTGCGGTGCTGTTATCGGCTGGACGCGCGGAACCGGACTCATGAGCGCGAATAAT
GGTGTCGCGGAAGATATTGAGAAGATGGGAGTGAGGACGTTCTCCCAGGTCGAAATGGCCTACTACATCCTTGTC
CTTATGTCATCTCCAATTGCAACCGAATGCGAGGTGACACCAGTGCAGGCAGACCTAAGCGGTGGCATGGGTCAC
TTCCCGAATTTCAAAGAGACGGTTGATTCCATCCGGCAGAAACAGAAGGAAACCAGTGAAATCCGAGACGCCTTG
GCAAAGGAGGAAGCCTTTGAGCGCGCTGCCCTTGGACAGCCATCGGAAGAAGAACCGCAGGTACGGGAACAAAAG
GCCAAGCTTGCGCTCGAGTTTCCTCGTCTACCTGACTACCAGACCGAGCTTCTTCCTCTCGCCGGTCAGTTGCGC
GGAATGGTTGATCTCGACCGCGTGGTCGTCGTCACCGGTTTCTCTGAAGTCGGGCCACACGGCAACGCCCGGACA
CGCTGGGAGATGGAGGCATTCGGGGAGTTCTCGCTAGAGGGCTGCATTGAGATGGCTTGGATCATGGGTCTGATC
AAGCATCACAATGGACCTCTCAACGGGAATCCGCATTACCATGGTTGGATCGTTGCAGCGACCAAGGAGCCTATT
CGCGATATCGATGTAAAGAAGCGGTTCGAAGAGCACATCCTGGCACACACCGGCATTCGACTCATTGAGCCAGAG
ATCAACGATGGCTACGATCCTTACAAGAAGAAATTCTTGCAGGAAGTGGTTCTCGACGAGGACATGCCTCCGTTT
AAGACGTCCAAGGAGACCGCAGAGCAACTCCGACTGGAGCACGGCGATAAGGTTGATGTCATCCCCGAAGGCGAA
GAGTACACCGTCCGCCTACTCAAGGGAGCTTGCCTGATGATCCCAAAGGCCCTTCGATTCGACCGGGCAGTGGCT
GGCCAGATTCCGACCGGCTGGGATGCCCGTACTTACGGGCTTACCGAGGATCTCGCCAGTCAAGTGGATCCAGCC
ACATTATATGCTCTCATTGGAACGGTGGAAGCACTTTTGAGTGCAGGAATCAGTGACCCATTCGAGATATACCAG
TATTTGCATGTGTCGGAAATCGGCAATTGCATTGGCTCTGGCTTGGGAGGCGTCAAGGCACTCCGAAAGCTGCAT
AAGGACCGCTTCGTGGAGAAGCAGGTTCAGAACGACATTTTGCAGGAATCATTCATCAACACCACGGCTGCATGG
ATTAACATGCTCTTGCTGTCCTCCACCGGCCCTATCCGAACCCCGGTCGGCGCTTGCGCCACCTCGATTGAGTCG
CTCGAATCCGGCTACGAGACTATCGTCTCCGGCAAAGCCAAGATGTGCCTTGTTGGTGGCTTCGACGACTTCTCC
GAGGATGTGTCGTATGAGTTCGCGAAGATGAAGGCCACGGTTAGTAGCGAGGCAGAGTTTGAAAAAGGTCGTGAT
CCCAGCGAGATGTCGCGACCGGCTGCTTCCACCCGTGCTGGATTCGTCGAGTCTCAAGGCAGTGGTATCCAGGTG
ATCACATCCGCCCAGCTGGCATTGGACATGGGCCTTCCCATCCAGGGCATCGTCGCATGGGTCGGAACTGCTAGT
GACAAGATTGGGCGTTCTGTTCCTGCTCCCGGAAAGGGTCTCTTGACGAATGCACGCGAGGCACGACACCGAGCC
CCGTCCCCCATGTTGGATATTTCTTACCGGCGTCGGAGACTGAATATGTCGCTCCAGCACATCAAGGAACGCGTC
GACATGGAGGTGGACATTGCTGAGGCAGAACTGACCGACCTCAAGCGCAGCCCTAGCCCCTACGCGGAAGAACGC
ATTGAAGAGATCAACGAACGCCTCCGCTACGTACGCCGGGAAGCCCGGGTCCAAGAGAAGGATGCGTTGAACACG
TTTGGTAATCATTTCTGGAAGAATAACCCGGAGATTTCTCCGCTACGCGGTGCTCTAGCAACTTGGAACCTGACT
ATCAACGACCTGGATGTGGTCTCGTTCCACGGGACATCCACCGTGTTGAACGAGAAGAACGAGACGAACATGATT
AGCCAACAGCTGCATCATCTGGGTCGGACGAAGGGTAATCCTGCATTAGGAATCTTCCAGAAGTATCTTACTGGA
CACTCAAAGGGTGCTGCAGGAGCGTGGATGCTCAATGGTGGCCTACAAGTGCTCAACACCGGCTTGGTTCCAGGC
AACCGCAATGCAGACAACATCGACGCAGCCCTGCAGAACGACTATTTAGTCTACCCCAGTCGCAGCATACAGACT
ACAGGTGTCAAGGCCTTTTCGGTAACATCTTTCGGGTTCGGACAGAAAGGAGCGCAAGCCTTGGGTGTTCATGCC
CGCTATCTCTTCGCCACGCTGGACCAGGAGACCTATGACGCGTATCGGGTCCGAGTTGAAGCAAGACAGCGCCGG
GCGCAGCAGCAATTCCGGTTTGGCATTGCACACAATGCTGTCTTTTCTGCTAAAGAGGCACCGCCATACCGGAAT
GATCAAGAGTTCCGCATTCTGCTGGATCCGGAGGCGCGTTTGACCGAGAATGCCCGGGGGCAGATGGAATATGCG
GAGTAA
Gene >Ani_SJS28_1|g3174.t1
ATGGCACCCAAGGAGAAGATGCATCCCCGGGTCCAGCGGGAGCTGGCGTACGTGTTGTTGACTGAACTTCTTGCG
TGAGTTTGCTTCTCAGTGTTGGGAGGCATTGCATCTGATGTTTTCTCTTTAGGTACCAGTTTGCTTCACCGGTCA
GGTGGTACGTTACCCTGGATCATTTGCGCTTGGCAAGGCAGGGCGTAATGTGCAGTCGCTAAGATTCCACAGGAT
TGAAACACAAGACGTCGTGCTCCAGGAACAAAAGGTTGATCGGCTGGTCGAGATTGGACCTGCTGAGACTTTGCT
TGGCATGATAAAGAAGACATTGGGAGCAAAGTACCAAGTCCATGATGCTGCACTTGCCATCCAACGAGAGATCTG
GAGTCATAAGAAGAATGCACGAGAGATATACTATGAATTGAACGATGCCGAGATCGTACCAACCCAAACAGGCAA
GGAGGCATCCACGCCCGCTGCACAGCCCTCACAGCCCACCCCTATCACACTCCCGGAGGCAGCTGAGACCGCCAC
GCCCAAGCCAGTACCAGTGCGGCAATCCCCTTCCAGCATTGAAGACACCCCGATAGCAGCACTCGACATTATCGT
CGCCCTGATCGCACACAAACTGAAGAAGCCGTTGCAAGACATTGACTTGAGCCAAACCATCAAGAAGCTGGTCGG
AGGTGAGCTTCTCGTTCCTACTCTTCCCGTGTTATCCCCACGACCACACCTGGCTTCATATTAACAATCCATAGG
CCGATCCACCCTAGAGAATGAGATCGTCGGAGACCTCGGCGCCGAGTTTGGCTCCATTCCAGACGCCCCCGAAGA
TACTCCCCTGTCGGAGCTCTCTCAATCCATCGAGGCTCAAGGTTCATGGAAGAAAGGCCTGGGCAAGACCACACA
GACCATTGTCAACCGAATGGTGTCGGCAAAAATGCCTGCGGGTCTGGGGTCAGGCGAAGTACGAGCTCACCTGCT
TAACAAATATGGCATACAGACAGGCCGCCAGGATGCGGTTCTGCTGCGCGCCGCGGTGCAGCAGCCCGCTGCAAG
ACTCCCAGATACTAGCGCTGCTCATGCTTTTCTTGAAGACATCGTCCAACAGTACGCTCAATATGCGAAGATTGA
TCTGTCTGCTATAGGAGCTTCGTCTGATGGGGCTGGCACATCATCTGGGCCAGTTGTGGTAGACCAGACTGCCGT
CAAGGCACTGACTAAGACTCAGGACGACCGGGCCCAAGCCATGCTGGAGTTGTATGCAAAGTTGCTTGGGGTAGA
CCTGCAGGCTGGACACAAGGCCAGCAACAAAGCAGCAGAAATTATAGCAGAGCTACAGGACGAGCTGCAGCTCTG
GATTTCGGAGCATGGTGAGGTTTACGGTTCGGGCATCAGGCCTATGCTATCCGTGGCCAAAGCCCGCAGGTACGA
CTCGTTTTGGAATTGGGCGCTACAAGACACTGTGGACCTGTTTCACCGGATCCTGGCCGGGACCATTACGCTAAC
TGGCCGCGAGGTGGAAACCATCATGGGCCGTATTGCTCGGAAGTCCAATTCAAAACTCGTGCAGATGCTAGAATA
CCTGGAGACACAGTGCCTGAAGCTTCGAAACCCGCGAGCGGTTCATGCCCGCGATGTCCTCCATCAATTGCGGCT
GGCATGCAACCCGCAGTTATCAGATGCTCAGCCATTGGCTGCGCACCGGTTGATGATAGACGCACCGAAGACAGC
CATTGACAGCCAAGGAAAAATTCATTATATGGAGGTTCCTCGTGCCACCGTCGATGCCGCACCACCGGCTACCCT
CAAATCACTGGGGAGCCAGGGTTGGGAAACCCGAGCGGACTTGACTGCAGCCTTCATGGCGACTCTTCGCCAAAC
GGAACACGAGTGTCTTTCGTTCTCAGACGCAGAGGTGCTTGTCATTGGTGCGGGACGGGATTCTATCGGCACCGA
AATTGTCCGCGGCCTTCTGAGAGGAGGTGCTCGGGTACTCGTAACGACCAGTAGTTACTCGCTCACGACAACACG
ACTGTATCAACAAATCTATGCCGAAGAAGGGGCTCGTGGATCGCAGCTCGTTCTCCTGCCCTTCAACCAAGCGAG
TCAGCAAGACCTTGAGTCCCTGGTGTCTTACATCTATGATTCCGACAAAGGGCTCGGATGGGATTTGAGCCATGT
TGTCCCATTTGCAGCCATTCCAGAAGGTGGCCGGCAAATTGAGGACATCGACTCTAAGTCAGAGTTGGCCCATCG
TATCATGCTGACAAACACGATCAGGTTGCTAGGAGCAATCAAGAAGCAGAAGCAGGCACGAGGATTCGACAGTCA
CCCTGCACAGGTAATCCTGCCATTGTCGCCGAACCACGGCATTTTTGGTGGAGATGGCCTGTACCCCGAGTCGAA
GATTGCTCTCGAAACACTATTCAACCGCTGGAGCTCCGAGTCATGGGGTACATATCTTTCAATCTGCGGTGCTGT
TATCGGCTGGACGCGCGGAACCGGACTCATGAGCGCGAATAATGGTGTCGCGGAAGATATTGAGAAGATGGGAGT
GAGGACGTTCTCCCAGGTCGAAATGGCCTACTACATCCTTGTCCTTATGTCATCTCCAATTGCAACCGAATGCGA
GGTGACACCAGTGCAGGCAGACCTAAGCGGTGGCATGGGTCACTTCCCGAATTTCAAAGAGACGGTTGATTCCAT
CCGGCAGAAACAGAAGGAAACCAGTGAAATCCGAGACGCCTTGGCAAAGGAGGAAGCCTTTGAGCGCGCTGCCCT
TGGACAGCCATCGGAAGAAGAACCGCAGGTACGGGAACAAAAGGCCAAGCTTGCGCTCGAGTTTCCTCGTCTACC
TGACTACCAGACCGAGCTTCTTCCTCTCGCCGGTCAGTTGCGCGGAATGGTTGATCTCGACCGCGTGGTCGTCGT
CACCGGTTTCTCTGAAGTCGGGCCACACGGCAACGCCCGGACACGCTGGGAGATGGAGGCATTCGGGGAGTTCTC
GCTAGAGGGCTGCATTGAGATGGCTTGGATCATGGGTCTGATCAAGCATCACAATGGACCTCTCAACGGGAATCC
GCATTACCATGGTTGGATCGTTGCAGCGACCAAGGAGCCTATTCGCGATATCGATGTAAAGAAGCGGTTCGAAGA
GCACATCCTGGCACACACCGGCATTCGACTCATTGAGCCAGAGATCAACGATGGCTACGATCCTTACAAGAAGAA
ATTCTTGCAGGAAGTGGTTCTCGACGAGGACATGCCTCCGTTTAAGACGTCCAAGGAGACCGCAGAGCAACTCCG
ACTGGAGCACGGCGATAAGGTTGATGTCATCCCCGAAGGCGAAGAGTACACCGTCCGCCTACTCAAGGGAGCTTG
CCTGATGATCCCAAAGGCCCTTCGATTCGACCGGGCAGTGGCTGGCCAGATTCCGACCGGCTGGGATGCCCGTAC
TTACGGGCTTACCGAGGATCTCGCCAGTCAAGTGGATCCAGCCACATTATATGCTCTCATTGGAACGGTGGAAGC
ACTTTTGAGTGCAGGAATCAGTGACCCATTCGAGATATACCAGTATTTGCATGTGTCGGAAATCGGCAATTGCAT
TGGCTCTGGCTTGGGAGGCGTCAAGGCACTCCGAAAGCTGCATAAGGACCGCTTCGTGGAGAAGCAGGTTCAGAA
CGACATTTTGCAGGAATCATTCATCAACACCACGGCTGCATGGATTAACATGCTCTTGCTGTCCTCCACCGGCCC
TATCCGAACCCCGGTCGGCGCTTGCGCCACCTCGATTGAGTCGCTCGAATCCGGCTACGAGACTATCGTCTCCGG
CAAAGCCAAGATGTGCCTTGTTGGTGGCTTCGACGACTTCTCCGAGGATGTGTCGTATGAGTTCGCGAAGATGAA
GGCCACGGTTAGTAGCGAGGCAGAGTTTGAAAAAGGTCGTGATCCCAGCGAGATGTCGCGACCGGCTGCTTCCAC
CCGTGCTGGATTCGTCGAGTCTCAAGGCAGTGGTATCCAGGTGATCACATCCGCCCAGCTGGCATTGGACATGGG
CCTTCCCATCCAGGGCATCGTCGCATGGGTCGGAACTGCTAGTGACAAGATTGGGCGTTCTGTTCCTGCTCCCGG
AAAGGGTCTCTTGACGAATGCACGCGAGGCACGACACCGAGCCCCGTCCCCCATGTTGGATATTTCTTACCGGCG
TCGGAGACTGAATATGTCGCTCCAGCACATCAAGGAACGCGTCGACATGGAGGTGGACATTGCTGAGGCAGAACT
GACCGACCTCAAGCGCAGCCCTAGCCCCTACGCGGAAGAACGCATTGAAGAGATCAACGAACGCCTCCGCTACGT
ACGCCGGGAAGCCCGGGTCCAAGAGAAGGATGCGTTGAACACGTTTGGTAATCATTTCTGGAAGAATAACCCGGA
GATTTCTCCGCTACGCGGTGCTCTAGCAACTTGGAACCTGACTATCAACGACCTGGATGTGGTCTCGTTCCACGG
GACATCCACCGTGTTGAACGAGAAGAACGAGACGAACATGATTAGCCAACAGCTGCATCATCTGGGTCGGACGAA
GGGTAATCCTGCATTAGGAATCTTCCAGAAGTATCTTACTGGACACTCAAAGGGTGCTGCAGGAGCGTGGATGCT
CAATGGTGGCCTACAAGTGCTCAACACCGGCTTGGTTCCAGGCAACCGCAATGCAGACAACATCGACGCAGCCCT
GCAGAACGACTATTTAGTCTACCCCAGTCGCAGCATACAGACTACAGGTGTCAAGGCCTTTTCGGTAACATCTTT
CGGGTTCGGACAGAAAGGAGCGCAAGCCTTGGGTGTTCATGCCCGCTATCTCTTCGCCACGCTGGACCAGGAGAC
CTATGACGCGTATCGGGTCCGAGTTGAAGCAAGACAGCGCCGGGCGCAGCAGCAATTCCGGTTTGGCATTGCACA
CAATGCTGTCTTTTCTGCTAAAGAGGCACCGCCATACCGGAATGATCAAGAGTTCCGCATTCTGCTGGATCCGGA
GGCGCGTTTGACCGAGAATGCCCGGGGGCAGATGGAATATGCGGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail