Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS27_1|g904.t1
Gene name
Locationscaffold_003:144977..147823
Strand+
Gene length (bp)2846
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 3.8E-20 18 363
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 2.7E-12 20 233
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 6.8E-08 87 221
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.2E-06 18 240
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.2E-05 21 74

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0050661 NADP binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0004497 monooxygenase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 535 557 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 4 Decorating

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup8604
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g5918.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g9221.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g6553.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g6575.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g7501.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g6809.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g4775.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g6797.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g10430.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g5435.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7515.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g2990.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g8547.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g7736.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g8037.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g7782.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g6748.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g6884.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g7721.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g8443.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g904.t1 (this protein)
Aspergillus niger CBS 147482 Ani_SJS55_1|g6629.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g7173.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g6149.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS27_1|g904.t1
MPSNYTQHVGNHDFTRATVVIIGAGVSGMCMAIDLLHRTPIRKFVILEQGSSVGGTWANNLYPGCASDVCSSLYS
YSFEQRPDWAAEYPGQEEFLTYMTDVAQKHGLYKYIRFNSTVQEARWDDQQQQWKVKVALNSAKASEFHEQYELT
TDFLVSGVGQLNVPSYPSISGLDDYTGKLIHSARWDWTYDFSGKRIGVIGNGASAIQIVPELAKTASHITIYQRS
PKWLLPRSNKKIGAIQHFLLSYVPPLRWCKRILQMRYREWLYNVLVTPGTVPARQFEAQSQEWMKSQLPDKPELW
DTLTPNYAIGCKRVLISDDFYAALNASHVDLNTRPIQRITATGVQTDDDEQEYDLIVLATGFRASEFLHPIRVYG
AGGRSLEDIWKDGPRAYYGMTVEDVPNFGMLYGPNTNLGHNSVITMIEAQSRYLSTMIRAVADAKKKDQTLVIQP
RPEVLREYNGRVQKHLAETSFADPNCQSWYKTAEGLITNNWPFTVVRYQKEVSQVRWADFILKGSGSAAVAKKKA
TYVGRVKEEALVSNVTLFLGVALAAGGVYWRATSWWKWKGSSTCESQWNQSTSGVKYLECME*
Coding >Ani_SJS27_1|g904.t1
ATGCCCTCCAACTACACTCAGCATGTCGGAAATCATGATTTTACTCGTGCCACCGTCGTGATTATCGGAGCCGGC
GTATCAGGGATGTGCATGGCCATCGACCTCCTTCATCGAACCCCCATCCGAAAATTCGTCATACTTGAGCAGGGA
AGCTCGGTCGGTGGAACCTGGGCCAACAATCTCTACCCGGGCTGTGCATCCGACGTCTGTAGCTCTTTGTACAGC
TATTCATTCGAGCAACGTCCCGACTGGGCAGCAGAGTATCCGGGTCAGGAAGAGTTTCTGACATATATGACAGAT
GTCGCGCAGAAACACGGCCTCTACAAATACATCCGTTTCAACTCGACTGTACAGGAAGCCCGCTGGGATGACCAG
CAACAGCAATGGAAGGTTAAGGTGGCCCTGAACAGCGCTAAGGCTAGCGAATTCCACGAGCAATATGAACTCACC
ACCGACTTTTTGGTATCAGGCGTTGGGCAACTAAATGTGCCCAGCTATCCCTCCATTTCAGGCCTGGATGACTAT
ACCGGCAAGTTGATTCACTCCGCCAGATGGGACTGGACCTACGACTTCTCTGGCAAGCGGATTGGCGTGATTGGA
AACGGCGCCTCGGCAATCCAAATCGTCCCCGAACTAGCCAAAACTGCCTCTCATATCACCATCTACCAGCGCAGT
CCGAAATGGCTCCTCCCTCGCTCTAACAAGAAAATCGGCGCTATCCAGCATTTCTTGCTATCTTATGTACCGCCC
TTGCGCTGGTGCAAGCGAATTCTGCAGATGCGTTACCGAGAATGGTTATACAACGTCCTTGTCACCCCCGGCACA
GTCCCAGCCCGCCAATTTGAGGCGCAATCACAGGAATGGATGAAAAGCCAGTTGCCCGATAAGCCTGAATTGTGG
GACACTCTGACCCCAAACTATGCCATTGGATGCAAGCGCGTTCTCATCTCCGATGACTTCTATGCTGCCTTGAAC
GCGAGTCACGTCGATCTCAATACCCGACCGATTCAACGCATCACAGCCACGGGGGTGCAAACAGACGATGACGAG
CAGGAATACGACCTCATTGTACTGGCCACTGGCTTCCGTGCTTCGGAATTCCTGCACCCGATCCGGGTGTACGGT
GCTGGTGGCCGATCTCTGGAAGATATCTGGAAGGACGGACCCAGAGCATACTATGGTATGACGGTCGAGGATGTG
CCGAATTTCGGCATGCTCTATGGGCCCAACACGAACTTGGGCCACAACTCCGTTATCACAATGATCGAAGCTCAA
TCAAGATACCTAAGCACAATGATCCGGGCCGTAGCGGACGCAAAGAAGAAGGACCAAACATTGGTCATCCAACCC
AGGCCAGAAGTGCTGCGAGAATACAACGGGCGGGTCCAGAAACACTTGGCTGAAACCAGTTTCGCCGATCCTAAT
TGCCAAAGCTGGTACAAGACTGCTGAGGGCCTGATCACGAATAACTGGCCATTCACAGTGGTGCGGTACCAGAAA
GAGGTGTCTCAGGTGCGGTGGGCGGACTTCATTCTCAAGGGTAGTGGCTCTGCTGCGGTGGCGAAGAAGAAGGCG
ACTTATGTTGGTCGGGTTAAGGAAGAGGCGCTAGTTAGCAATGTTACGCTGTTCTTGGGAGTGGCCCTGGCGGCT
GGGGGAGTTTATTGGCGTGCTACGAGCTGGTGGAAGTGGAAGGGTTCATCAACTTGTGAGAGCCAGTGGAACCAG
AGCACATCAGGGGTGAAGTATTTGGAATGCATGGAGTGA
Transcript >Ani_SJS27_1|g904.t1
ATGCCCTCCAACTACACTCAGCATGTCGGAAATCATGATTTTACTCGTGCCACCGTCGTGATTATCGGAGCCGGC
GTATCAGGGATGTGCATGGCCATCGACCTCCTTCATCGAACCCCCATCCGAAAATTCGTCATACTTGAGCAGGGA
AGCTCGGTCGGTGGAACCTGGGCCAACAATCTCTACCCGGGCTGTGCATCCGACGTCTGTAGCTCTTTGTACAGC
TATTCATTCGAGCAACGTCCCGACTGGGCAGCAGAGTATCCGGGTCAGGAAGAGTTTCTGACATATATGACAGAT
GTCGCGCAGAAACACGGCCTCTACAAATACATCCGTTTCAACTCGACTGTACAGGAAGCCCGCTGGGATGACCAG
CAACAGCAATGGAAGGTTAAGGTGGCCCTGAACAGCGCTAAGGCTAGCGAATTCCACGAGCAATATGAACTCACC
ACCGACTTTTTGGTATCAGGCGTTGGGCAACTAAATGTGCCCAGCTATCCCTCCATTTCAGGCCTGGATGACTAT
ACCGGCAAGTTGATTCACTCCGCCAGATGGGACTGGACCTACGACTTCTCTGGCAAGCGGATTGGCGTGATTGGA
AACGGCGCCTCGGCAATCCAAATCGTCCCCGAACTAGCCAAAACTGCCTCTCATATCACCATCTACCAGCGCAGT
CCGAAATGGCTCCTCCCTCGCTCTAACAAGAAAATCGGCGCTATCCAGCATTTCTTGCTATCTTATGTACCGCCC
TTGCGCTGGTGCAAGCGAATTCTGCAGATGCGTTACCGAGAATGGTTATACAACGTCCTTGTCACCCCCGGCACA
GTCCCAGCCCGCCAATTTGAGGCGCAATCACAGGAATGGATGAAAAGCCAGTTGCCCGATAAGCCTGAATTGTGG
GACACTCTGACCCCAAACTATGCCATTGGATGCAAGCGCGTTCTCATCTCCGATGACTTCTATGCTGCCTTGAAC
GCGAGTCACGTCGATCTCAATACCCGACCGATTCAACGCATCACAGCCACGGGGGTGCAAACAGACGATGACGAG
CAGGAATACGACCTCATTGTACTGGCCACTGGCTTCCGTGCTTCGGAATTCCTGCACCCGATCCGGGTGTACGGT
GCTGGTGGCCGATCTCTGGAAGATATCTGGAAGGACGGACCCAGAGCATACTATGGTATGACGGTCGAGGATGTG
CCGAATTTCGGCATGCTCTATGGGCCCAACACGAACTTGGGCCACAACTCCGTTATCACAATGATCGAAGCTCAA
TCAAGATACCTAAGCACAATGATCCGGGCCGTAGCGGACGCAAAGAAGAAGGACCAAACATTGGTCATCCAACCC
AGGCCAGAAGTGCTGCGAGAATACAACGGGCGGGTCCAGAAACACTTGGCTGAAACCAGTTTCGCCGATCCTAAT
TGCCAAAGCTGGTACAAGACTGCTGAGGGCCTGATCACGAATAACTGGCCATTCACAGTGGTGCGGTACCAGAAA
GAGGTGTCTCAGGTGCGGTGGGCGGACTTCATTCTCAAGGGTAGTGGCTCTGCTGCGGTGGCGAAGAAGAAGGCG
ACTTATGTTGGTCGGGTTAAGGAAGAGGCGCTAGTTAGCAATGTTACGCTGTTCTTGGGAGTGGCCCTGGCGGCT
GGGGGAGTTTATTGGCGTGCTACGAGCTGGTGGAAGTGGAAGGGTTCATCAACTTGTGAGAGCCAGTGGAACCAG
AGCACATCAGGGGTGAAGTATTTGGAATGCATGGAGTGA
Gene >Ani_SJS27_1|g904.t1
ATGCCCTCCAACTACACTCAGCATGTCGGAAATCATGATTTTACTCGTGCCACCGTCGTGATTATCGGAGCCGGC
GTATCAGGTAGAACATGAACCTCATGCTTGTGACCTGGGGAATTGTGAACTCTGTAGCTAACAGACTCCAGGGAT
GTGCATGGCCATCGACCTCCTTCATCGAACCCCCATCCGAAAATTCGTCATACTTGAGCAGGGAAGCTCGGTCGG
TGGAACCTGGGCCAACAATCTCTACCCGGGCTGTGCATCCGACGGTAAGAAGCGACCGATCCAACATGATTGTTG
GCATGAATAACCAAGAGTCGCGTAGTCTGTAGCTCTTTGTACAGCTATTCATTCGAGCAACGTCCCGACTGGGCA
GCAGAGTATCCGGGTCAGGAAGAGTTTCTGGTAATCTTGTCCTCCATTCTGGGAATATGAGAGGCTGACGCATCC
GCAGACATATATGACAGATGTCGCGCAGAAACACGGCCTCTACAAATACATCCGTTTCAACTCGACTGTACAGGA
AGCCCGCTGGGATGACCAGCAACAGCAATGGAAGGTTAAGGTGGCCCTGAACAGCGCTAAGGCTAGCGAATTCCA
CGAGCAATATGAACTCACCACCGACTTTTTGGTATCAGGCGTTGGGCAACTAAATGTGCCCAGCTATCCCTCCAT
TTCAGGCCTGGATGACTATACCGGCAAGTTGATTCACTCCGCCAGATGGGACTGGACCTACGACTTCTCTGGCAA
GCGGATTGGCGTGATTGGAAACGGTATCTACTTCATACCCAGTGAAATACTCTGACATCAAAGGCTGACGGCAAT
GATAGGCGCCTCGGCAATCCAAATCGTCCCCGAACTAGCCAAAACTGCCTCTCATATCACCATCTACCAGCGCAG
TCCGAAATGGCTCCTCCCTCGCTCTAACAAGAAAATCGGCGCTATCCAGCATTTCTTGCTATCTTATGTACCGCC
CTTGCGCTGGTGCAAGCGAATTCTGCAGATGCGTTACCGAGAATGGTTATACAACGTCCTTGTCACCCCCGGCAC
AGTCCCAGCCCGCCAATTTGAGGCGCAATCACAGGAATGGATGAAAAGCCAGTTGCCCGATAAGCCTGAATTGTG
GGACACTCTGACCCCAAACTATGCCATTGGATGCAAGCGCGTTCTCATCTCCGATGACTTCTATGCTGCCTTGAA
CGCGAGTCACGTCGATCTCAATACCCGACCGATTCAACGCATCACAGCCACGGGGGTGCAAACAGACGATGACGA
GCAGGAATACGACCTCATTGTACTGGCCACTGGCTTCCGTGCTTCGGAATTCCTGCACCCGATCCGGGTGTACGG
TGCTGGTGGCCGATCTCTGGAAGATATCTGGAAGGACGGACCCAGAGCATACTATGGTATGACGGTCGAGGATGT
GCCGAATTTCGGCATGCTCTATGGGCCCAACACGAACTTGGGTGTGTTCATCTTTCCATCCGAAATTATTAGAGT
GCATACACTGACAGGAATAGGCCACAACTCCGTTATCACAATGATCGAAGCTCAATCAAGATACCTAAGCACAAT
GATCCGGGCCGTAGCGGACGCAAAGAAGAAGGACCAAACATTGGTCATCCAACCCAGGCCAGAAGTGCTGCGAGA
ATACAACGGGCGGGTCCAGAAACACTTGGCTGAAACCAGTTTCGCCGATCCTAATTGCCAAAGCTGGTACAAGAC
TGCTGAGGGCCTGATCACGAATAACTGGCCATTCACAGTGGTGCGGTACCAGAAAGAGGTGTCTCAGGTGCGGTG
GGCGGACTTCATTCTCAAGGGTAGTGGCTCTGCTGCGGTGGCGAAGAAGAAGGCGACTTATGTTGGTCGGGTTAA
GGAAGAGGCGCTAGTTAGCAATGTTACGCTGTTCTTGGGAGTGGCCCTGGCGGCTGGGGGAGTTTATTGGCGTGC
TACGAGCTGGTGGAAGTGGTAGGTTTGGAATATGCTGGTGTGTCGGACCGATTTGTCGTCGGATATGTTTTTAGT
CGAGGTAATGAATTAGCATGTTTGATTGTCTGAGTAGGGAGGTGCCTCTCATAGACAAAGTAGGTGACGATGGCA
TTCTTTCAGGCTCTGGAAAGACTGCCTGGACCTCGCGTGTTTGCCCCGGTGCCCACTGTGCGAGCGGCTTGCTGA
GAATTTTATCTCTGAGGAGGGCATGAGATGCTGGGTCGAATAAGTACCCGGCGTGTTCGTCGGACGTGACATTGG
GCTGGTCATGCATGGAGACTATAATTATCAACAGAGTGGACGCTGTCCGAGGCATGTCTATCAGCAGTACGCGGT
GTCGAGGGCTTTGAATAATATCCATTCGTGGGGTGGCTTTTAAGATCCGTACCACAAGTTTCCCGAGTAAAAGTC
TAATGAGTGGAACGCCTTCCAGAAAATGGAAGGTATAATGGGAGTTGAAATGGAACTCGTAGTGCCCTCAATGTG
TCTGTGAAATGATGTTCTCTCAGATTCACCTTGTCGATATTATCTTTCTCGGGCCCGCCAGATTGACTCATGACC
TGACTATGCATCATTTACAGCTGGATGCGATGAGGCAGCTGATCGCGGCATTGCATGATACCATATCTTCACAAA
CCCCATTGTGGGACAAAGAACTCAAGGGATTTTGAATGTGGAGTTTACAGTGCAAAGTCTACCTGACTGGTAATC
ATCAAGCTGATGAATATACCATTATTGGACGTAACCAGAACGATAGCCTTACTCGTACTGCTGAGTACAGGAAGG
GTTCATCAACTTGTGAGAGCCAGTGGAACCAGAGCACATCAGGGGTGAAGTATTTGGAATGCATGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail