Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS18_1|g7227.t1
Gene name
Locationscaffold_056:134060..137139
Strand-
Gene length (bp)3079
Transcript length (bp)2835
Coding sequence length (bp)2835
Protein length (aa) 945

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02366 PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 2.4E-82 64 312
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 6.4E-68 559 757
PF02815 MIR MIR domain 3.7E-46 360 535

GO

GO Term Description Terminal node
GO:0006493 protein O-linked glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043412 macromolecule modification No
GO:0005575 cellular_component No
GO:0070085 glycosylation No
GO:0006486 protein glycosylation No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0019538 protein metabolic process No
GO:0003824 catalytic activity No
GO:0043413 macromolecule glycosylation No
GO:0016757 glycosyltransferase activity No
GO:0036211 protein modification process No
GO:0016758 hexosyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0110165 cellular anatomical entity No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 102 124 22
2 144 166 22
3 173 190 17
4 195 217 22
5 230 247 17
6 251 273 22
7 286 308 22
8 613 635 22
9 656 678 22
10 718 740 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT39 1.9E-74 65 310

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup8278
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g7215.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g3062.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g7524.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g8479.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g8883.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g5761.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g3428.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g7096.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g9837.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g4522.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g9096.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g6881.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g7197.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g5258.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g6965.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g5459.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g7984.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g8608.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g7546.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g8057.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g4490.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g5612.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g7227.t1 (this protein)
Aspergillus niger CBS 769.97 Ani_SJS82_1|g7816.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS18_1|g7227.t1
MATKSKDTLAVTPPPKSSSRSPSRSPGPKSRKKAAAASSSYASDGVTDNNIFYLPSSDYKTLALVTIVAAVVRLF
RIYQPSSVVFDEVHFGGFATKYIKGRFFMDVHPPLAKLLITLAGWLAGFDGEFDFKDIGKDYLEPGVPYVAMRML
PAILGVLTIPLMFLTLRASGCRTITAVLGAGVVIFENGLITQSRLILLDSPLVFFTALTALSFTCFTNQQELGPS
HSFRGPWWFWLVATGLSLGATLSVKWVGLFTVAWVGSLTVLQLWVLLGDPKNVTPRLWFKHFFARVFCLIVIPLS
FYCAMFGIHFLCLVNPGDGDGFMSSEFQATLNSKGMQDVPADVAFGSRVSIRHLNTQGGYLHSHNHMYPTGSKQQ
QITLYPHKDENNIFVLENQTQPLGPYGTVEGPLAWDNITAEYIEDGAVIRLNHLITRRRIHSHDERPPVTDVDWQ
FEVSAYGYDGFPGDANDLFRVEIVKSLSEGEEAKKRLRTIQTKFRLVHIMTNCVLFSHKVKLPEWGFDQQEVTCA
RGATLPNSIWYIESNSHPMLADDVEKVNYKNPGFFGKFWELQKVMWITNAGLTESHAWDSRPPSWPTLLRGINFW
GKDHRQVYLLGNPFIWWSSTVAIVIYIIFKGVSVLRWQRSCGDYHNVNFKRFDYEIGTSVLGWAFHYFPFYLMAR
QLFLHHYFPALYFAIIALCQEFDFLANRIKSLGIPSRPVIGKVLAGIFLAISIFTFTLYSPLVYGNPWTQDACNS
VKLMDSWDFDCHTFYTSLDQYVTQIVDTHAAIPTTQTSVQQVPPVVMEQPPQQQVPQQVQQQNQEVLQEEAQEPG
VTPRARHTAKARVEYRDQHGNVLDEELVAQLKKEGKVQFESRHETKTRLENGRIVDMIDGQIAPPHPDVEGQNPE
TVGRQPPQAVEDGPASVAGQGSSQEQRGSPDPKPASEANEATKS*
Coding >Ani_SJS18_1|g7227.t1
ATGGCAACCAAATCCAAAGATACCTTGGCGGTTACGCCGCCGCCAAAATCATCCTCACGCTCTCCCAGCCGCTCT
CCGGGTCCCAAGAGCCGCAAGAAGGCCGCCGCGGCCTCCTCGAGCTATGCATCCGATGGCGTTACGGACAACAAT
ATCTTCTATCTTCCCTCCTCCGACTATAAAACCCTAGCTCTGGTGACCATTGTTGCGGCGGTGGTCCGGTTGTTC
AGGATCTACCAGCCTTCTAGCGTTGTCTTCGACGAAGTCCACTTCGGAGGTTTTGCGACAAAGTACATCAAGGGC
CGCTTCTTCATGGATGTCCATCCTCCTCTTGCCAAGTTGCTCATCACACTTGCTGGCTGGCTGGCGGGCTTTGAT
GGCGAATTCGATTTCAAGGACATTGGAAAGGATTATCTCGAACCGGGCGTACCATATGTTGCCATGCGCATGCTT
CCGGCGATTTTGGGTGTTCTCACGATCCCATTGATGTTTCTGACATTGAGGGCATCGGGATGCCGCACTATTACT
GCGGTGCTAGGTGCCGGTGTCGTCATCTTTGAGAACGGTCTCATTACTCAGTCTCGTTTAATTCTCTTGGATTCC
CCATTGGTGTTCTTCACTGCGCTCACCGCATTGTCTTTCACGTGCTTTACCAACCAACAGGAATTGGGACCTTCT
CATTCCTTCCGTGGACCCTGGTGGTTCTGGCTCGTGGCAACTGGCCTCTCTCTGGGCGCTACTCTCAGCGTCAAA
TGGGTTGGACTCTTCACCGTTGCTTGGGTTGGGTCGCTTACTGTTCTCCAACTGTGGGTGCTGCTTGGCGATCCG
AAGAATGTCACACCGCGCCTGTGGTTCAAGCACTTCTTTGCTCGTGTCTTCTGCCTGATTGTTATTCCCCTCAGC
TTCTACTGCGCCATGTTTGGAATCCACTTCCTGTGCCTTGTCAACCCCGGCGATGGAGATGGATTCATGTCCTCC
GAGTTCCAAGCAACCCTGAACTCCAAGGGGATGCAGGACGTTCCCGCCGATGTTGCATTTGGTTCCCGCGTCAGC
ATCCGTCACCTCAACACCCAAGGAGGCTATCTTCATTCTCACAATCACATGTACCCCACGGGAAGCAAGCAGCAG
CAGATAACGCTCTACCCCCACAAGGATGAGAACAACATTTTCGTCCTTGAGAACCAGACTCAGCCTCTTGGTCCC
TACGGAACAGTGGAGGGCCCCTTGGCCTGGGACAACATCACCGCAGAGTATATCGAAGACGGAGCTGTGATCAGG
TTGAATCACCTTATCACTCGGAGGCGAATTCACTCGCATGATGAGCGGCCTCCTGTCACAGATGTGGATTGGCAA
TTCGAGGTGTCTGCCTATGGATACGACGGATTCCCGGGAGATGCAAACGATCTCTTCCGTGTTGAAATTGTGAAA
TCTCTGTCTGAGGGTGAGGAGGCGAAGAAGCGACTGCGGACTATCCAGACCAAGTTCCGTCTGGTGCACATCATG
ACTAACTGTGTCTTGTTTTCCCACAAAGTCAAGCTTCCCGAGTGGGGTTTCGACCAGCAAGAGGTGACCTGTGCC
AGAGGAGCTACTTTGCCCAACAGCATCTGGTATATTGAGTCGAACAGCCACCCTATGCTCGCAGACGATGTTGAA
AAGGTCAACTACAAGAACCCCGGTTTCTTCGGCAAGTTCTGGGAGCTGCAGAAGGTGATGTGGATTACCAACGCG
GGCCTAACTGAATCGCACGCTTGGGACTCTCGCCCGCCTTCCTGGCCAACCCTCCTCCGTGGCATCAACTTCTGG
GGCAAGGATCACCGCCAAGTCTACCTCCTGGGCAACCCCTTCATCTGGTGGTCTTCAACCGTGGCCATCGTTATC
TACATTATTTTCAAGGGAGTCTCTGTTCTTCGCTGGCAGCGGAGCTGTGGTGACTACCACAACGTGAACTTCAAG
CGGTTCGACTACGAAATTGGTACCAGCGTACTTGGCTGGGCTTTCCACTACTTCCCCTTCTACCTCATGGCGCGA
CAGCTCTTCCTGCACCATTATTTCCCTGCCCTCTATTTCGCTATCATCGCCCTCTGTCAGGAATTCGACTTCCTT
GCCAACCGTATTAAGAGTCTTGGGATACCATCTCGCCCTGTTATCGGCAAAGTGTTGGCCGGTATCTTCCTTGCG
ATTAGCATCTTTACTTTCACACTGTACTCGCCTCTGGTCTACGGCAACCCCTGGACACAGGACGCTTGCAACAGT
GTAAAGCTCATGGACAGCTGGGACTTTGACTGCCACACATTCTACACTAGCCTTGACCAGTATGTGACCCAAATT
GTGGACACCCACGCGGCCATCCCCACGACTCAGACATCGGTACAACAAGTACCCCCCGTTGTGATGGAACAACCA
CCGCAGCAGCAGGTCCCGCAGCAGGTCCAGCAACAGAACCAGGAAGTCCTGCAGGAGGAGGCCCAGGAACCGGGT
GTCACGCCCCGGGCTCGGCACACTGCCAAGGCCCGTGTGGAATACCGTGATCAACACGGAAACGTGCTGGACGAA
GAACTTGTTGCTCAGTTAAAGAAGGAAGGTAAGGTCCAGTTCGAGAGCCGTCATGAGACGAAGACTCGCCTGGAG
AACGGCCGCATTGTCGACATGATCGACGGTCAAATCGCCCCGCCTCACCCCGACGTTGAAGGTCAGAACCCTGAA
ACTGTTGGAAGACAGCCACCTCAGGCTGTAGAGGACGGCCCAGCCTCAGTAGCCGGGCAAGGAAGCTCCCAGGAG
CAGCGCGGCTCGCCTGACCCCAAGCCGGCCAGTGAGGCCAATGAGGCTACCAAATCTTGA
Transcript >Ani_SJS18_1|g7227.t1
ATGGCAACCAAATCCAAAGATACCTTGGCGGTTACGCCGCCGCCAAAATCATCCTCACGCTCTCCCAGCCGCTCT
CCGGGTCCCAAGAGCCGCAAGAAGGCCGCCGCGGCCTCCTCGAGCTATGCATCCGATGGCGTTACGGACAACAAT
ATCTTCTATCTTCCCTCCTCCGACTATAAAACCCTAGCTCTGGTGACCATTGTTGCGGCGGTGGTCCGGTTGTTC
AGGATCTACCAGCCTTCTAGCGTTGTCTTCGACGAAGTCCACTTCGGAGGTTTTGCGACAAAGTACATCAAGGGC
CGCTTCTTCATGGATGTCCATCCTCCTCTTGCCAAGTTGCTCATCACACTTGCTGGCTGGCTGGCGGGCTTTGAT
GGCGAATTCGATTTCAAGGACATTGGAAAGGATTATCTCGAACCGGGCGTACCATATGTTGCCATGCGCATGCTT
CCGGCGATTTTGGGTGTTCTCACGATCCCATTGATGTTTCTGACATTGAGGGCATCGGGATGCCGCACTATTACT
GCGGTGCTAGGTGCCGGTGTCGTCATCTTTGAGAACGGTCTCATTACTCAGTCTCGTTTAATTCTCTTGGATTCC
CCATTGGTGTTCTTCACTGCGCTCACCGCATTGTCTTTCACGTGCTTTACCAACCAACAGGAATTGGGACCTTCT
CATTCCTTCCGTGGACCCTGGTGGTTCTGGCTCGTGGCAACTGGCCTCTCTCTGGGCGCTACTCTCAGCGTCAAA
TGGGTTGGACTCTTCACCGTTGCTTGGGTTGGGTCGCTTACTGTTCTCCAACTGTGGGTGCTGCTTGGCGATCCG
AAGAATGTCACACCGCGCCTGTGGTTCAAGCACTTCTTTGCTCGTGTCTTCTGCCTGATTGTTATTCCCCTCAGC
TTCTACTGCGCCATGTTTGGAATCCACTTCCTGTGCCTTGTCAACCCCGGCGATGGAGATGGATTCATGTCCTCC
GAGTTCCAAGCAACCCTGAACTCCAAGGGGATGCAGGACGTTCCCGCCGATGTTGCATTTGGTTCCCGCGTCAGC
ATCCGTCACCTCAACACCCAAGGAGGCTATCTTCATTCTCACAATCACATGTACCCCACGGGAAGCAAGCAGCAG
CAGATAACGCTCTACCCCCACAAGGATGAGAACAACATTTTCGTCCTTGAGAACCAGACTCAGCCTCTTGGTCCC
TACGGAACAGTGGAGGGCCCCTTGGCCTGGGACAACATCACCGCAGAGTATATCGAAGACGGAGCTGTGATCAGG
TTGAATCACCTTATCACTCGGAGGCGAATTCACTCGCATGATGAGCGGCCTCCTGTCACAGATGTGGATTGGCAA
TTCGAGGTGTCTGCCTATGGATACGACGGATTCCCGGGAGATGCAAACGATCTCTTCCGTGTTGAAATTGTGAAA
TCTCTGTCTGAGGGTGAGGAGGCGAAGAAGCGACTGCGGACTATCCAGACCAAGTTCCGTCTGGTGCACATCATG
ACTAACTGTGTCTTGTTTTCCCACAAAGTCAAGCTTCCCGAGTGGGGTTTCGACCAGCAAGAGGTGACCTGTGCC
AGAGGAGCTACTTTGCCCAACAGCATCTGGTATATTGAGTCGAACAGCCACCCTATGCTCGCAGACGATGTTGAA
AAGGTCAACTACAAGAACCCCGGTTTCTTCGGCAAGTTCTGGGAGCTGCAGAAGGTGATGTGGATTACCAACGCG
GGCCTAACTGAATCGCACGCTTGGGACTCTCGCCCGCCTTCCTGGCCAACCCTCCTCCGTGGCATCAACTTCTGG
GGCAAGGATCACCGCCAAGTCTACCTCCTGGGCAACCCCTTCATCTGGTGGTCTTCAACCGTGGCCATCGTTATC
TACATTATTTTCAAGGGAGTCTCTGTTCTTCGCTGGCAGCGGAGCTGTGGTGACTACCACAACGTGAACTTCAAG
CGGTTCGACTACGAAATTGGTACCAGCGTACTTGGCTGGGCTTTCCACTACTTCCCCTTCTACCTCATGGCGCGA
CAGCTCTTCCTGCACCATTATTTCCCTGCCCTCTATTTCGCTATCATCGCCCTCTGTCAGGAATTCGACTTCCTT
GCCAACCGTATTAAGAGTCTTGGGATACCATCTCGCCCTGTTATCGGCAAAGTGTTGGCCGGTATCTTCCTTGCG
ATTAGCATCTTTACTTTCACACTGTACTCGCCTCTGGTCTACGGCAACCCCTGGACACAGGACGCTTGCAACAGT
GTAAAGCTCATGGACAGCTGGGACTTTGACTGCCACACATTCTACACTAGCCTTGACCAGTATGTGACCCAAATT
GTGGACACCCACGCGGCCATCCCCACGACTCAGACATCGGTACAACAAGTACCCCCCGTTGTGATGGAACAACCA
CCGCAGCAGCAGGTCCCGCAGCAGGTCCAGCAACAGAACCAGGAAGTCCTGCAGGAGGAGGCCCAGGAACCGGGT
GTCACGCCCCGGGCTCGGCACACTGCCAAGGCCCGTGTGGAATACCGTGATCAACACGGAAACGTGCTGGACGAA
GAACTTGTTGCTCAGTTAAAGAAGGAAGGTAAGGTCCAGTTCGAGAGCCGTCATGAGACGAAGACTCGCCTGGAG
AACGGCCGCATTGTCGACATGATCGACGGTCAAATCGCCCCGCCTCACCCCGACGTTGAAGGTCAGAACCCTGAA
ACTGTTGGAAGACAGCCACCTCAGGCTGTAGAGGACGGCCCAGCCTCAGTAGCCGGGCAAGGAAGCTCCCAGGAG
CAGCGCGGCTCGCCTGACCCCAAGCCGGCCAGTGAGGCCAATGAGGCTACCAAATCTTGA
Gene >Ani_SJS18_1|g7227.t1
ATGGCAACCAAATCCAAAGATACCTTGGCGGTTACGCCGCCGCCAAAATCATCCTCACGCTCTCCCAGCCGCTCT
CCGGGTCCCAAGAGCCGCAAGAAGGCCGCCGCGGCCTCCTCGAGCTATGCATCCGATGGCGTTACGGACAACAAT
ATCTTCTATCTTCCCTCCTCCGACTATAAAACCCTAGCTCTGGTGACCATTGTTGCGGCGGTGGTCCGGTTGTTC
AGGATCTACCAGCCTTCTAGCGTTGTCTTCGACGAAGTCCAGTACGTGTGCATACCTTTTTCCGCCCCCGCATAT
GCCGGAGATAATCTTGTTCTAATGCATGGCGGACAGCTTCGGAGGTTTTGCGACAAAGTACATCAAGGGCCGCTT
CTTCATGGATGTCCATCCTCCTCTTGCCAAGTTGCTCATCACACTTGCTGGCTGGCTGGCGGGCTTTGATGGCGA
ATTCGATTTCAAGGACATTGGAAAGGATTATCTCGAACCGGGCGTACCATATGTTGCCATGCGCATGCTTCCGGC
GATTTTGGGTGTTCTCACGATCCCATTGATGTTTCTGACATTGAGGGCATCGGGATGCCGCACTATTACTGCGGT
GCTAGGTGCCGGTGTCGTCATCTTTGGTATGCCTCCACGCCTCTCCGACTGGTCAATTGCACAAGCTGATTCAAA
GCAGAGAACGGTCTCATTACTCAGTCTCGTTTAATTCTCTTGGATTCCCCATTGGTGTTCTTCACTGCGCTCACC
GCATTGTCTTTCACGTGCTTTACCAACCAACAGGAATTGGGACCTTCTCATTCCTTCCGTGGACCCTGGTGGTTC
TGGCTCGTGGCAACTGGCCTCTCTCTGGGCGCTACTCTCAGCGTCAAATGGGTTGGACTCTTCACCGTTGCTTGG
GTTGGGTCGCTTACTGTTCTCCAACTGTGGGTGCTGCTTGGCGATCCGAAGAATGTCACACCGGTATGTGCTTCC
AATCATCGATCTAGATCTGCTTGAGACAGGGGCTAACCTCTTATCATACAGCGCCTGTGGTTCAAGCACTTCTTT
GCTCGTGTCTTCTGCCTGATTGTTATTCCCCTCAGCTTCTACTGCGCCATGTTTGGAATCCACTTCCTGTGCCTT
GTCAACCCCGGCGATGGAGATGGATTCATGTCCTCCGAGTTCCAAGCAACCCTGAACTCCAAGGGGATGCAGGAC
GTTCCCGCCGATGTTGCATTTGGTTCCCGCGTCAGCATCCGTCACCTCAACACCCAAGGAGGCTATCTTCATTCT
CACAATCACATGTACCCCACGGGAAGCAAGCAGCAGCAGATAACGCTCTACCCCCACAAGGATGAGAACAACATT
TTCGTCCTTGAGAACCAGACTCAGCCTCTTGGTCCCTACGGAACAGTGGAGGGCCCCTTGGCCTGGGACAACATC
ACCGCAGAGTATATCGAAGACGGAGCTGTGATCAGGTTGAATCACCTTATCACTCGGAGGCGAATTCACTCGCAT
GATGAGCGGCCTCCTGTCACAGATGTGGATTGGCAATTCGAGGTGTCTGCCTATGGATACGACGGATTCCCGGGA
GATGCAAACGATCTCTTCCGTGTTGAAATTGTGAAATCTCTGTCTGAGGGTGAGGAGGCGAAGAAGCGACTGCGG
ACTATCCAGACCAAGTTCCGTCTGGTGCACATCATGACTAACTGTGTCTTGTTTTCCCACAAAGTCAAGCTTCCC
GAGTGGGGTTTCGACCAGCAAGAGGTGACCTGTGCCAGAGGAGCTACTTTGCCCAACAGCATCTGGTATATTGAG
TCGAACAGCCACCCTATGCTCGCAGACGATGTTGAAAAGGTCAACTACAAGAACCCCGGTTTCTTCGGCAAGTTC
TGGGAGCTGCAGAAGGTGATGTGGATTACCAACGCGGGCCTAACTGAATCGCACGCTTGGGACTCTCGCCCGCCT
TCCTGGCCAACCCTCCTCCGTGGCATCAACTTCTGGGGCAAGGATCACCGCCAAGTCTACCTCCTGGGCAACCCC
TTCATCTGGTGGTCTTCAACCGTGGCCATCGTTATCTACATTATTTTCAAGGGAGTCTCTGTTCTTCGCTGGCAG
CGGAGCTGTGGTGACTACCACAACGTGAACTTCAAGCGGTTCGACTACGAAATTGGTACCAGCGTACTTGGCTGG
GCTTTCCACTACTTCCCCTTCTACCTCATGGCGCGACAGCTCTTCCTGCACCATTATTTCCCTGCCCTCTATTTC
GCTATCATCGCCCTCTGTCAGGAATTCGACTTCCTTGCCAACCGTATTAAGAGTCTTGGGATACCATCTCGCCCT
GTTATCGGCAAAGTGTTGGCCGGTATCTTCCTTGCGATTAGCATCTTTACTTTCACACTGTACTCGCCTCTGGTC
TACGGCAACCCCTGGACACAGGACGCTTGCAACAGTGTAAAGCTCATGGACAGCTGGGACTTTGACTGCCACACA
TTCTACACTAGCGTAAGTCTCCCGGGTACCGCAGCCAATACGCATGTTGTAGATGCTGACATGATTACAGCTTGA
CCAGTATGTGACCCAAATTGTGGACACCCACGCGGCCATCCCCACGACTCAGACATCGGTACAACAAGTACCCCC
CGTTGTGATGGAACAACCACCGCAGCAGCAGGTCCCGCAGCAGGTCCAGCAACAGAACCAGGAAGTCCTGCAGGA
GGAGGCCCAGGAACCGGGTGTCACGCCCCGGGCTCGGCACACTGCCAAGGCCCGTGTGGAATACCGTGATCAACA
CGGAAACGTGCTGGACGAAGAACTTGTTGCTCAGTTAAAGAAGGAAGGTAAGGTCCAGTTCGAGAGCCGTCATGA
GACGAAGACTCGCCTGGAGAACGGCCGCATTGTCGACATGATCGACGGTCAAATCGCCCCGCCTCACCCCGACGT
TGAAGGTCAGAACCCTGAAACTGTTGGAAGACAGCCACCTCAGGCTGTAGAGGACGGCCCAGCCTCAGTAGCCGG
GCAAGGAAGCTCCCAGGAGCAGCGCGGCTCGCCTGACCCCAAGCCGGCCAGTGAGGCCAATGAGGCTACCAAATC
TTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail