Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS18_1|g5844.t1
Gene name
Locationscaffold_039:266922..268039
Strand+
Gene length (bp)1117
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 1.0E-62 68 302

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 59 81 22
3 96 118 22
4 135 157 22
5 198 220 22
6 233 255 22
7 275 294 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup8019
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g6476.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g7683.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g7168.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g6932.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g4915.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g4372.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g2824.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g5045.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g5558.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g2298.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g3257.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g9051.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g2896.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g6490.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g3476.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g3075.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g10278.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g5802.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g6318.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g7789.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g4217.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g4316.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g5844.t1 (this protein)
Aspergillus niger CBS 769.97 Ani_SJS82_1|g1544.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS18_1|g5844.t1
MSASGHGSSETQTYGSDTCHAYVDGVSTSYGYVPSLAAASTFVALFGASMLGHAVQMAWFRTWWCSVFSLGCLVE
ILGWAARIWSAKCPYAQTPYLMQITTLIIAPTFFTAGIYVLLARFIRIFGPQSSVLSPKLYLWIFCTCDIISLVV
QAAGGGMASSGGGGGGGDSSSSTSSLSTRETSSSNSQSTGTHIMVGGIIFQLVAITVFVALGADFAWRVFCREVP
SRRGNTHMPIVIGLFSAMVLSVLLIYIRSVYRTIELLHGWTSSTMRNEKLLIGLDGAMMVPAVIVFNLFHPGQLL
RKIELRANSVPMVSEQTLVLEDFEEESQGDKLVLLGRG*
Coding >Ani_SJS18_1|g5844.t1
ATGAGTGCTTCAGGCCACGGAAGCTCAGAAACACAGACATACGGCAGCGATACATGCCATGCCTATGTGGATGGC
GTGTCAACTTCATACGGCTATGTGCCCTCGCTCGCAGCAGCCTCTACCTTTGTAGCTCTCTTTGGCGCTTCGATG
CTAGGCCATGCTGTCCAAATGGCGTGGTTCCGTACCTGGTGGTGTTCCGTGTTCTCACTAGGATGCTTGGTCGAA
ATCCTAGGTTGGGCGGCCCGAATATGGTCTGCTAAGTGCCCCTACGCTCAGACACCATATCTCATGCAAATCACT
ACCCTCATCATAGCACCAACGTTCTTCACCGCAGGAATTTACGTACTGCTAGCCCGTTTCATTCGCATCTTCGGC
CCCCAATCATCTGTCCTTTCTCCTAAGCTCTACCTCTGGATCTTCTGCACCTGCGATATTATCTCTTTGGTTGTC
CAGGCAGCAGGAGGAGGTATGGCTTCATCAGGAGGAGGTGGTGGTGGTGGGGACTCGTCCTCCAGCACCAGCTCG
TTGAGCACCAGAGAGACCTCCTCCTCCAACTCCCAATCAACCGGAACCCACATCATGGTCGGCGGCATCATCTTC
CAGCTCGTGGCTATAACAGTCTTCGTTGCCCTTGGCGCTGATTTTGCCTGGCGCGTATTCTGCCGCGAAGTACCA
TCCCGCCGGGGTAACACGCACATGCCGATAGTGATCGGTTTGTTTTCGGCAATGGTGCTTTCGGTCCTCTTGATA
TATATTCGGAGTGTATATCGGACGATTGAGTTGCTACATGGGTGGACCAGTTCAACAATGCGAAATGAAAAATTG
TTAATTGGGTTGGATGGGGCGATGATGGTTCCGGCTGTTATTGTTTTCAATCTCTTTCATCCGGGGCAGTTATTG
CGGAAGATTGAATTGCGGGCGAATTCGGTGCCCATGGTGAGCGAGCAGACATTGGTCTTGGAGGACTTTGAGGAG
GAGAGTCAGGGGGATAAGTTGGTTTTGTTGGGAAGGGGCTAG
Transcript >Ani_SJS18_1|g5844.t1
ATGAGTGCTTCAGGCCACGGAAGCTCAGAAACACAGACATACGGCAGCGATACATGCCATGCCTATGTGGATGGC
GTGTCAACTTCATACGGCTATGTGCCCTCGCTCGCAGCAGCCTCTACCTTTGTAGCTCTCTTTGGCGCTTCGATG
CTAGGCCATGCTGTCCAAATGGCGTGGTTCCGTACCTGGTGGTGTTCCGTGTTCTCACTAGGATGCTTGGTCGAA
ATCCTAGGTTGGGCGGCCCGAATATGGTCTGCTAAGTGCCCCTACGCTCAGACACCATATCTCATGCAAATCACT
ACCCTCATCATAGCACCAACGTTCTTCACCGCAGGAATTTACGTACTGCTAGCCCGTTTCATTCGCATCTTCGGC
CCCCAATCATCTGTCCTTTCTCCTAAGCTCTACCTCTGGATCTTCTGCACCTGCGATATTATCTCTTTGGTTGTC
CAGGCAGCAGGAGGAGGTATGGCTTCATCAGGAGGAGGTGGTGGTGGTGGGGACTCGTCCTCCAGCACCAGCTCG
TTGAGCACCAGAGAGACCTCCTCCTCCAACTCCCAATCAACCGGAACCCACATCATGGTCGGCGGCATCATCTTC
CAGCTCGTGGCTATAACAGTCTTCGTTGCCCTTGGCGCTGATTTTGCCTGGCGCGTATTCTGCCGCGAAGTACCA
TCCCGCCGGGGTAACACGCACATGCCGATAGTGATCGGTTTGTTTTCGGCAATGGTGCTTTCGGTCCTCTTGATA
TATATTCGGAGTGTATATCGGACGATTGAGTTGCTACATGGGTGGACCAGTTCAACAATGCGAAATGAAAAATTG
TTAATTGGGTTGGATGGGGCGATGATGGTTCCGGCTGTTATTGTTTTCAATCTCTTTCATCCGGGGCAGTTATTG
CGGAAGATTGAATTGCGGGCGAATTCGGTGCCCATGGTGAGCGAGCAGACATTGGTCTTGGAGGACTTTGAGGAG
GAGAGTCAGGGGGATAAGTTGGTTTTGTTGGGAAGGGGCTAG
Gene >Ani_SJS18_1|g5844.t1
ATGAGTGCTTCAGGCCACGGAAGCTCAGAAACACAGACATACGGCAGCGATACATGCCATGCCTATGTGGATGGC
GTGTCAACTTCATACGGCTATGTGCCCTCGCTCGCAGCAGCCTCTACCTTTGTAGCTCTCTTTGGCGCTTCGATG
CTAGGCCATGCTGTCCAAATGGCGTGGTTCCGTACCTGGTGGTGTTCCGTGTTCTCACTAGGATGCTTGGGTATC
TTGACCACCGCAGAGGCTAGATCGATTATGCTGACTGGAACACAGTCGAAATCCTAGGTTGGGCGGCCCGAATAT
GGTCTGCTAAGTGCCCCTACGCTCAGACACCATATCTCATGCAAATCACTACCCTCATCATAGGTGAGATATCCC
ATTGCTAGTACAGGGGCACATCTGACGTTCATTGATAGCACCAACGTTCTTCACCGCAGGAATTTACGTACTGCT
AGCCCGTTTCATTCGCATCTTCGGCCCCCAATCATCTGTCCTTTCTCCTAAGCTCTACCTCTGGATCTTCTGCAC
CTGCGATATTATCTCTTTGGTTGTCCAGGCAGCAGGAGGAGGTATGGCTTCATCAGGAGGAGGTGGTGGTGGTGG
GGACTCGTCCTCCAGCACCAGCTCGTTGAGCACCAGAGAGACCTCCTCCTCCAACTCCCAATCAACCGGAACCCA
CATCATGGTCGGCGGCATCATCTTCCAGCTCGTGGCTATAACAGTCTTCGTTGCCCTTGGCGCTGATTTTGCCTG
GCGCGTATTCTGCCGCGAAGTACCATCCCGCCGGGGTAACACGCACATGCCGATAGTGATCGGTTTGTTTTCGGC
AATGGTGCTTTCGGTCCTCTTGATATATATTCGGAGTGTATATCGGACGATTGAGTTGCTACATGGGTGGACCAG
TTCAACAATGCGAAATGAAAAATTGTTAATTGGGTTGGATGGGGCGATGATGGTTCCGGCTGTTATTGTTTTCAA
TCTCTTTCATCCGGGGCAGTTATTGCGGAAGATTGAATTGCGGGCGAATTCGGTGCCCATGGTGAGCGAGCAGAC
ATTGGTCTTGGAGGACTTTGAGGAGGAGAGTCAGGGGGATAAGTTGGTTTTGTTGGGAAGGGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail