Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS14_1|g6012.t1
Gene name
Locationscaffold_039:103104..110646
Strand+
Gene length (bp)7542
Transcript length (bp)7221
Coding sequence length (bp)7221
Protein length (aa) 2407

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00063 Myosin_head Myosin head (motor domain) 1.6E-267 173 852
PF01576 Myosin_tail_1 Myosin tail 1.0E-15 1274 2357
PF02736 Myosin_N Myosin N-terminal SH3-like domain 2.2E-10 117 161

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016459 myosin complex Yes
GO:0003774 cytoskeletal motor activity Yes
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0032991 protein-containing complex No
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005575 cellular_component No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup8394
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g1810.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g2405.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g5754.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g1997.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g6012.t1 (this protein)
Aspergillus niger CBS 124.48 Ani_SJS7_1|g8481.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g680.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g10582.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g2392.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g9595.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g4759.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g9949.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g10719.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g6932.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g8513.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g8930.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g5032.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g9725.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g10376.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g8179.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g715.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g4564.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g8408.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g4251.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS14_1|g6012.t1
MLPSQLNGSPKRANPFSRASPSPTPSPTQQTRGIRPKSAVVTSPSKFEEARGHFRNSASISQSPSPLVARTTHRP
RSSSIRNDVSSGTFAPEFIKSEELRRGADQIRGQEGDNDFSGNKYVWLRDTEKAFVRGLVLEEQEGGRMLVQTDN
GEQREVDADQVDKVNPAKFDKADDMAELTHLNEASVVHNLHTRYQADLIYTYSGLFLVTVNPYCPLPIYTNEYVK
MYKGRNREESRPHIFAMADEAFRNLVEEGENQSILVTGESGAGKTENTKKVIQYLAAVATTDTPYARSGTKQLSA
LSQQILRANPILEAFGNAQTVRNNNSSRFGKFIRIEFTRAGQISGASIDWYLLEKSRVVKPNSHERNYHIFYQLL
RGADRKLREALLLSDLQIEDFAYTRDGNDTIAGVSDEDEWKMLIEAFHVMDFSEEDQMCILRTIAAVLHLGNITI
VKESLRADQAALGPDSLNSVERACHLLGIEPELFVKGLLHPKVKAGREWVEKVQTPEQVRLALDALAKGIYERGF
SNLVDRINNQLDRSTVAGDDSFFIGVLDIAGFEIFKNNSFEQLCINYTNEKLQQFFNHHMFVLEQEEYAREQIEW
QFIDFGKDLQPTIDLIELTNPIGIFSCLDEDSVMPKATDKSFTEKLHSLWDRKSPKYRASRLSQGFVLTHYAAEV
EYGTEGWLEKNKDPLNDNITRLLARSGEKHVATLFSDCGDADDDSDYPKSRVKKGLFRTVAQRHKEQLSSLMNQL
NSTHPHFVRCIIPNHKKRPKMFNAPLVLDQLRCNGVLEGIRIARTGFPNRLSFSEFRQRYEVLCPAMPKGYLDGR
NAAHVMLQKLGLDPAWYRVGRTKVFFRAGVLAELEEKRDQLIRTIMTRFQSVARGFVQRRISNKRLYRAEATRII
QDNFKSYLQLKANPWWRLYSRMRPLLGETRTANEVKRRDEKIKSLEAKMNQDIADRQKLEEERRRTEIEIQKIQQ
TLESERALALDKEEIFKRLQVREVELSEKLAGAIADQESLEDQLDDLIAAKKRTDDELELRITQLEQAGEIIQRF
ENEKHEMQARLEELEKKLAEAESSSLEKEAKIKELGQELKMLQSHLSLKERKLQDLETKLLKTDQDLEVKLSKTS
RDLDQSKKHIKELIEENRVIRQQITDLSSTSTGYEEMLRRKESEMAVLRNDAKKHEEEKRYLESEKVSLTTRHDS
MQERLRELQAEVDAMRSEKVQLEREAADVKKLLEAKISEDAEAGESRKLLEQQIQELKNQLFKAQADLSRERQSR
DDVQMLAEHNLAELKDKYTSLNESKIIIEKEMYIQQDTLRRATEARVAAEQSRKELQTELIQLRDRFTKVEDARL
NAEDDIERNIMKQANERLESVRKDLDDKTRQLEEVEAERSRLSTRIQELTHAIAESDNFRIRHDQHKERLERELV
TLKGRLTASENDNRALLTKIQQKNLDIARSTSRASDNSRLRITALQKEKTKLEEDNKKITRQLGDLQVNITSLEK
QKEKLSLSLEDLNHEVAREHKASRNAEKAASTANIQLAEANRNLETERQLRTQAQANTRKLQGSLDTANKEIEDL
HRQLMLLHKVVEPESDESESWEKVQPSLAKKVDLAQLLQTTQSRLQVTEEKYSRAEAQLAEMRRRHGDEMKELDA
RYASSKRALLEEIDQNQVASPRTPTHLRKNSDNVLAKKFGTPTTPNRRLNFNETANDSARSDRTVDTVGYQKRMD
LAAEIEELQNKLQMSEMQNKHLQNQLSQAAPGRDMWQEESPSLRRMQLLERENGRLHEQLDDSSKKVSALEKNIR
SGDLSLRDVQAKSHEELYDLINSQEQSRRSLLKVHNEAIAEFSDAKAQFEKLKRAKATLEVELRDARSEFQELQV
ARDQDAVSRNQLLQEFSDLQIRLDAETSKSADLASSMSLYKTRADEYFSKLEQAEIAVLKATRAEQFAKSQAQEA
EDTCAQIMSERKQMDALVEDLQRQTQSLEARMEDQAAELQGALQAKQRLQNELEDYRNQRAIDIEDKETSMEQTR
QKYQREFTTLNNELEMEREKVLNVRGENSRLREELEDLRSKWDNEVLNSSTWAKEKARMDIMLQDVTTSRDEAVN
AHNEAQSRVVSLLSQVRTLRTSVDDVTAERDMLLKEKKMLETRLAEAGERLEDLAKGESPSMRNAASMDRELLEL
KSKLAQQEDVSAAAVGKMRRAEALATEMQKEVTAERETNAQLFKDKAALEKQLKESQLRCVDLETKSYSSGSQDV
RFLHKRIKELETHLEDQEAKHSSEQRSLRNVDRTVKDLQSQIERRDKMNSQLNDDVSKARDKIERLLRNIEELQH
TDSETQLQVRRAERELREEREKSLRLERELEGWRALRVERGSVLGRSHVGAFSDAGSRRGSSVYGGDIPQRMPSN
TKGFLA*
Coding >Ani_SJS14_1|g6012.t1
ATGCTTCCATCACAGTTAAATGGCTCCCCTAAGCGGGCCAACCCTTTCAGCCGCGCATCGCCGTCACCGACTCCC
TCCCCAACTCAGCAGACAAGAGGTATTCGCCCCAAGTCGGCCGTTGTTACATCCCCCAGTAAATTCGAAGAGGCC
CGGGGCCATTTTCGAAACTCTGCTTCCATCTCACAGTCACCATCACCGTTGGTGGCACGGACAACGCATCGGCCG
AGGTCGAGCTCAATAAGGAATGATGTTTCATCAGGAACCTTTGCGCCCGAATTCATCAAGTCGGAGGAGCTACGC
AGGGGTGCGGATCAGATCCGGGGACAAGAGGGCGACAATGACTTCTCCGGCAACAAGTATGTCTGGCTCCGCGAT
ACCGAAAAGGCATTCGTGCGTGGGCTTGTTCTCGAAGAGCAAGAAGGTGGCCGGATGTTAGTCCAGACCGACAAT
GGAGAGCAAAGGGAGGTCGACGCTGACCAAGTCGACAAAGTGAACCCGGCGAAGTTTGATAAGGCAGATGATATG
GCTGAACTCACACATCTAAATGAAGCCTCAGTGGTTCACAATCTGCACACCCGATATCAAGCCGATCTCATCTAT
ACGTACTCCGGACTTTTCCTCGTTACTGTGAACCCATACTGCCCATTGCCAATCTACACAAACGAGTATGTGAAG
ATGTACAAGGGTCGTAACAGAGAAGAGAGCCGTCCCCACATCTTTGCTATGGCTGATGAGGCCTTTCGAAATCTG
GTCGAAGAAGGAGAGAACCAAAGCATTCTCGTGACGGGAGAGTCAGGTGCAGGTAAAACCGAGAACACCAAGAAG
GTTATACAATACCTTGCAGCTGTTGCGACAACCGACACCCCTTACGCTCGATCTGGCACTAAGCAATTGTCCGCC
CTGTCCCAACAGATTCTGAGGGCAAACCCCATTCTGGAGGCGTTTGGAAATGCCCAGACCGTCAGGAACAACAAC
TCTTCCCGCTTTGGCAAGTTCATTCGTATTGAGTTCACCCGGGCCGGCCAGATATCGGGTGCTTCGATCGATTGG
TATCTACTGGAGAAGTCTCGTGTCGTGAAACCCAATTCGCATGAAAGAAACTACCATATCTTCTACCAGTTATTA
CGGGGAGCAGACCGAAAGCTTAGGGAGGCTCTCCTTTTGTCCGACTTGCAGATTGAGGATTTCGCCTATACTCGT
GATGGTAACGACACCATTGCTGGGGTCTCTGATGAGGACGAATGGAAAATGTTGATTGAGGCTTTCCATGTTATG
GACTTTTCCGAGGAAGACCAGATGTGCATCTTGCGCACTATCGCAGCAGTCCTTCATCTGGGAAATATCACCATC
GTCAAGGAAAGCCTACGAGCCGATCAAGCTGCACTTGGCCCCGACTCCCTGAACAGTGTAGAGAGGGCTTGCCAC
TTGCTAGGTATAGAACCTGAGCTATTCGTCAAAGGACTGCTGCATCCCAAGGTCAAAGCAGGCCGCGAGTGGGTG
GAAAAGGTTCAAACGCCAGAACAGGTTCGACTAGCACTCGATGCTCTCGCCAAGGGTATCTATGAACGAGGATTT
AGCAATCTTGTCGACAGAATCAACAACCAGCTGGACCGCAGCACTGTCGCTGGCGATGACAGCTTCTTCATCGGA
GTCCTCGATATTGCGGGTTTCGAGATTTTCAAGAACAACAGCTTCGAACAGCTGTGCATCAACTATACCAACGAG
AAGCTGCAACAGTTTTTCAACCACCATATGTTCGTCTTAGAACAAGAGGAATACGCACGAGAGCAAATTGAGTGG
CAATTCATTGACTTCGGAAAGGACTTGCAACCAACAATTGACCTAATCGAGTTGACCAATCCTATTGGTATCTTT
TCGTGTCTAGATGAAGATTCTGTTATGCCGAAGGCTACAGACAAATCTTTTACTGAAAAGCTGCACTCGCTCTGG
GATCGGAAATCACCGAAGTATCGTGCTTCTCGGCTAAGCCAGGGATTCGTTCTGACGCACTACGCTGCTGAGGTA
GAGTATGGCACAGAGGGCTGGCTCGAGAAGAACAAGGACCCACTGAACGATAACATAACGCGACTGCTTGCAAGA
TCAGGTGAAAAACATGTCGCGACTCTGTTCTCCGACTGCGGCGACGCCGACGATGACAGCGACTACCCTAAGAGT
CGCGTGAAGAAGGGTCTCTTCCGCACCGTTGCGCAAAGACATAAGGAACAACTATCTAGCCTCATGAATCAGCTG
AACTCAACGCATCCTCACTTTGTGCGCTGTATTATACCCAACCACAAAAAGCGCCCGAAGATGTTCAACGCACCC
CTGGTCCTCGATCAGCTACGTTGCAACGGTGTACTCGAAGGAATACGAATTGCACGCACTGGGTTCCCTAATCGG
CTGTCATTTTCGGAATTCCGTCAACGCTACGAAGTTCTCTGCCCTGCCATGCCCAAGGGATACCTCGACGGCCGG
AATGCCGCTCATGTTATGTTGCAAAAGCTCGGGCTGGACCCTGCTTGGTATCGAGTCGGTCGTACGAAGGTATTC
TTCAGGGCAGGGGTCCTGGCCGAGTTGGAAGAGAAACGAGATCAGCTTATTCGCACCATCATGACCCGGTTCCAA
TCTGTGGCAAGGGGATTTGTCCAGCGGCGTATCTCCAACAAGCGCTTGTATCGGGCGGAAGCAACACGGATCATT
CAGGACAACTTCAAGTCTTACCTCCAGTTGAAAGCGAACCCATGGTGGAGACTGTATTCCAGGATGAGGCCTCTT
CTGGGAGAAACTCGCACTGCCAATGAAGTCAAAAGGCGGGACGAGAAGATCAAGTCCCTGGAAGCGAAGATGAAC
CAGGATATAGCTGATCGACAGAAGCTAGAGGAAGAGAGGCGTCGTACCGAGATTGAAATACAGAAGATTCAACAA
ACGTTGGAGAGTGAGCGTGCCTTGGCTCTCGACAAGGAGGAGATATTCAAGAGACTGCAAGTCCGAGAAGTTGAG
CTTAGTGAGAAGTTGGCCGGTGCTATCGCAGACCAGGAGAGCCTCGAAGACCAACTAGATGATCTGATAGCTGCC
AAGAAAAGAACGGATGACGAGCTTGAGCTCCGCATAACCCAACTTGAACAGGCAGGAGAAATCATCCAACGCTTT
GAGAACGAAAAGCATGAGATGCAGGCACGTCTAGAAGAACTCGAGAAGAAGCTGGCCGAGGCAGAAAGCTCTTCC
CTGGAGAAGGAGGCCAAGATCAAGGAGCTGGGCCAAGAGTTAAAGATGTTGCAGAGTCACCTCAGCTTGAAAGAG
CGCAAACTGCAAGATCTAGAGACCAAACTCTTGAAGACTGATCAAGATCTTGAAGTTAAGCTCTCCAAGACCTCG
AGAGACCTAGACCAGTCCAAGAAACACATCAAAGAGCTCATTGAAGAAAATCGGGTCATAAGACAACAAATCACC
GACCTCTCCTCAACATCCACTGGCTACGAAGAGATGCTTAGGCGAAAGGAAAGCGAAATGGCTGTTCTGCGAAAC
GATGCCAAGAAGCATGAAGAGGAGAAAAGATATCTAGAGTCGGAGAAGGTTTCTCTTACTACGCGACATGACAGC
ATGCAGGAGCGTCTACGAGAGCTGCAAGCTGAGGTAGACGCGATGAGGTCAGAGAAGGTTCAGCTTGAGCGAGAG
GCGGCCGATGTCAAGAAGCTACTGGAGGCAAAGATATCAGAGGATGCCGAGGCTGGCGAAAGCCGAAAGCTTCTC
GAGCAGCAAATCCAAGAATTGAAAAATCAACTCTTCAAAGCACAGGCTGATTTGAGCCGGGAGCGTCAATCGCGT
GATGATGTGCAAATGCTTGCCGAGCATAATCTCGCGGAGCTCAAGGACAAGTACACTTCCTTGAATGAATCAAAG
ATTATCATCGAAAAGGAGATGTACATTCAGCAGGACACTCTTCGTCGTGCCACGGAAGCCCGCGTTGCTGCTGAG
CAGTCACGCAAGGAACTTCAAACTGAATTGATTCAACTTCGGGACCGCTTCACGAAGGTCGAGGATGCGCGATTA
AACGCAGAGGACGACATTGAGCGCAACATCATGAAGCAGGCCAACGAGCGTCTTGAGAGTGTGCGCAAAGACCTG
GATGATAAGACACGCCAGCTGGAAGAGGTAGAAGCTGAAAGGTCACGTCTTTCCACCAGAATTCAAGAATTGACC
CACGCTATCGCTGAATCTGACAATTTCCGCATTCGCCATGATCAACATAAGGAACGCCTGGAGAGGGAATTGGTG
ACGCTCAAGGGTAGGCTTACAGCATCGGAAAATGATAACCGAGCTCTCCTCACAAAGATCCAACAAAAGAACCTC
GACATAGCCCGATCAACTTCCAGGGCCAGTGACAACTCGCGCCTGCGCATAACTGCTCTCCAGAAAGAAAAGACG
AAGCTCGAAGAGGACAACAAGAAAATAACCCGTCAGCTTGGCGATCTGCAAGTCAACATCACTTCTCTGGAGAAG
CAGAAAGAGAAGTTGTCTTTGAGCCTGGAGGACCTTAACCACGAGGTTGCTAGAGAACACAAGGCCAGTCGGAAT
GCGGAAAAGGCTGCTTCCACTGCCAACATCCAATTGGCGGAGGCGAACAGGAACCTTGAGACCGAAAGACAGCTC
CGGACCCAGGCACAAGCAAATACGCGCAAGCTTCAAGGCTCCCTGGATACGGCAAACAAGGAGATCGAAGATCTA
CACCGCCAATTGATGTTGCTGCACAAGGTAGTGGAGCCTGAGTCTGATGAATCGGAATCCTGGGAGAAGGTCCAG
CCTAGTCTGGCTAAGAAGGTTGATTTGGCACAATTGTTACAGACGACACAGAGTAGGTTGCAAGTCACCGAGGAG
AAGTATAGTCGAGCCGAGGCCCAATTGGCGGAAATGCGTCGTCGGCATGGGGATGAAATGAAGGAGCTGGATGCA
CGTTACGCCTCATCTAAACGCGCCTTGCTCGAGGAGATCGACCAGAACCAGGTAGCTAGCCCTCGGACCCCTACT
CACCTCAGAAAGAACTCCGACAATGTTCTGGCAAAGAAGTTCGGCACTCCTACAACGCCTAACCGTAGGCTTAAC
TTCAATGAAACGGCAAATGACTCTGCTCGATCTGACAGAACCGTGGATACTGTCGGCTACCAAAAGCGAATGGAT
CTGGCGGCCGAAATTGAGGAGCTGCAGAACAAGCTTCAAATGAGCGAAATGCAGAACAAACATCTCCAAAACCAG
CTTTCCCAAGCAGCACCTGGTCGTGATATGTGGCAGGAAGAAAGTCCTTCTCTTCGACGCATGCAGCTGCTTGAA
CGTGAGAACGGACGTCTACACGAGCAGCTCGATGACTCCTCTAAGAAGGTTTCTGCTCTTGAGAAGAACATTCGG
TCAGGTGATCTTTCACTGCGGGACGTCCAAGCCAAATCGCATGAAGAACTGTACGACCTAATCAACTCGCAGGAG
CAGTCCAGAAGGTCTTTGCTCAAGGTGCACAACGAAGCCATTGCAGAGTTCAGCGACGCCAAAGCTCAATTCGAA
AAGCTTAAGAGGGCTAAGGCTACGCTGGAAGTAGAACTCCGTGATGCCCGTTCCGAGTTCCAGGAGCTGCAGGTC
GCAAGGGACCAGGATGCTGTTAGTCGGAATCAGCTTCTTCAGGAGTTTTCTGACCTTCAAATCCGCTTGGATGCA
GAGACCTCGAAGTCAGCTGATTTGGCTTCCAGTATGAGCTTGTACAAGACCCGTGCCGATGAGTATTTCAGCAAA
CTGGAACAAGCTGAGATTGCAGTTCTGAAGGCTACTCGAGCAGAGCAATTCGCCAAATCCCAGGCCCAGGAGGCT
GAGGATACCTGTGCTCAGATAATGTCTGAGCGCAAACAAATGGATGCCCTGGTTGAAGACCTGCAACGTCAAACT
CAGTCGCTCGAGGCCAGAATGGAAGATCAAGCAGCTGAGCTCCAAGGTGCACTCCAGGCCAAACAGCGTCTCCAA
AACGAGCTTGAAGACTACAGAAACCAACGTGCCATTGATATTGAGGACAAGGAGACTTCAATGGAACAGACTAGG
CAAAAGTATCAGCGCGAATTTACCACGCTCAACAACGAATTGGAGATGGAGCGTGAAAAGGTCCTCAATGTTCGC
GGTGAGAACTCACGCCTCCGTGAAGAACTTGAAGACTTGCGGAGCAAGTGGGACAATGAAGTCTTGAACAGCTCT
ACTTGGGCTAAGGAGAAGGCTCGAATGGACATCATGCTTCAAGACGTGACGACATCTCGTGATGAGGCAGTGAAT
GCTCATAATGAAGCTCAAAGCAGGGTTGTCTCCCTCCTGTCCCAGGTGAGAACTCTTCGCACCTCCGTCGACGAC
GTGACCGCGGAGCGCGACATGCTGCTCAAGGAGAAGAAGATGCTGGAAACCCGGTTAGCTGAGGCAGGTGAAAGG
CTGGAGGATCTCGCCAAGGGCGAGAGTCCATCAATGCGCAATGCTGCAAGCATGGACCGTGAGTTGTTGGAACTT
AAGTCCAAGCTTGCTCAACAGGAAGATGTTTCCGCAGCTGCAGTTGGTAAGATGAGGCGGGCGGAAGCATTGGCG
ACGGAGATGCAGAAGGAAGTCACTGCTGAGAGAGAAACAAATGCTCAGCTCTTCAAGGACAAGGCGGCCCTCGAA
AAGCAGCTGAAGGAATCTCAACTTCGTTGCGTTGATCTCGAGACCAAGAGCTACTCATCTGGAAGCCAGGACGTC
CGATTCTTACACAAGAGAATCAAGGAACTGGAAACCCATCTGGAGGACCAAGAAGCCAAGCACAGTTCCGAGCAA
CGTTCGTTGCGGAATGTCGACCGCACGGTTAAAGACCTGCAGTCCCAGATCGAGCGCAGGGATAAGATGAATTCC
CAGCTCAATGACGACGTCAGCAAAGCTCGCGACAAGATCGAGCGTCTTCTTCGGAACATCGAGGAGCTTCAGCAC
ACCGACTCGGAGACACAGCTGCAAGTGCGCCGAGCAGAGCGAGAACTCCGGGAAGAGCGGGAGAAGTCTCTCAGG
CTGGAACGTGAACTAGAGGGATGGCGAGCGCTCCGGGTTGAGAGGGGCAGCGTCCTCGGACGTAGCCACGTCGGC
GCTTTCAGCGACGCCGGAAGCAGGAGAGGGAGCAGCGTGTACGGAGGCGATATACCGCAGCGGATGCCTAGCAAC
ACCAAAGGCTTCTTGGCCTGA
Transcript >Ani_SJS14_1|g6012.t1
ATGCTTCCATCACAGTTAAATGGCTCCCCTAAGCGGGCCAACCCTTTCAGCCGCGCATCGCCGTCACCGACTCCC
TCCCCAACTCAGCAGACAAGAGGTATTCGCCCCAAGTCGGCCGTTGTTACATCCCCCAGTAAATTCGAAGAGGCC
CGGGGCCATTTTCGAAACTCTGCTTCCATCTCACAGTCACCATCACCGTTGGTGGCACGGACAACGCATCGGCCG
AGGTCGAGCTCAATAAGGAATGATGTTTCATCAGGAACCTTTGCGCCCGAATTCATCAAGTCGGAGGAGCTACGC
AGGGGTGCGGATCAGATCCGGGGACAAGAGGGCGACAATGACTTCTCCGGCAACAAGTATGTCTGGCTCCGCGAT
ACCGAAAAGGCATTCGTGCGTGGGCTTGTTCTCGAAGAGCAAGAAGGTGGCCGGATGTTAGTCCAGACCGACAAT
GGAGAGCAAAGGGAGGTCGACGCTGACCAAGTCGACAAAGTGAACCCGGCGAAGTTTGATAAGGCAGATGATATG
GCTGAACTCACACATCTAAATGAAGCCTCAGTGGTTCACAATCTGCACACCCGATATCAAGCCGATCTCATCTAT
ACGTACTCCGGACTTTTCCTCGTTACTGTGAACCCATACTGCCCATTGCCAATCTACACAAACGAGTATGTGAAG
ATGTACAAGGGTCGTAACAGAGAAGAGAGCCGTCCCCACATCTTTGCTATGGCTGATGAGGCCTTTCGAAATCTG
GTCGAAGAAGGAGAGAACCAAAGCATTCTCGTGACGGGAGAGTCAGGTGCAGGTAAAACCGAGAACACCAAGAAG
GTTATACAATACCTTGCAGCTGTTGCGACAACCGACACCCCTTACGCTCGATCTGGCACTAAGCAATTGTCCGCC
CTGTCCCAACAGATTCTGAGGGCAAACCCCATTCTGGAGGCGTTTGGAAATGCCCAGACCGTCAGGAACAACAAC
TCTTCCCGCTTTGGCAAGTTCATTCGTATTGAGTTCACCCGGGCCGGCCAGATATCGGGTGCTTCGATCGATTGG
TATCTACTGGAGAAGTCTCGTGTCGTGAAACCCAATTCGCATGAAAGAAACTACCATATCTTCTACCAGTTATTA
CGGGGAGCAGACCGAAAGCTTAGGGAGGCTCTCCTTTTGTCCGACTTGCAGATTGAGGATTTCGCCTATACTCGT
GATGGTAACGACACCATTGCTGGGGTCTCTGATGAGGACGAATGGAAAATGTTGATTGAGGCTTTCCATGTTATG
GACTTTTCCGAGGAAGACCAGATGTGCATCTTGCGCACTATCGCAGCAGTCCTTCATCTGGGAAATATCACCATC
GTCAAGGAAAGCCTACGAGCCGATCAAGCTGCACTTGGCCCCGACTCCCTGAACAGTGTAGAGAGGGCTTGCCAC
TTGCTAGGTATAGAACCTGAGCTATTCGTCAAAGGACTGCTGCATCCCAAGGTCAAAGCAGGCCGCGAGTGGGTG
GAAAAGGTTCAAACGCCAGAACAGGTTCGACTAGCACTCGATGCTCTCGCCAAGGGTATCTATGAACGAGGATTT
AGCAATCTTGTCGACAGAATCAACAACCAGCTGGACCGCAGCACTGTCGCTGGCGATGACAGCTTCTTCATCGGA
GTCCTCGATATTGCGGGTTTCGAGATTTTCAAGAACAACAGCTTCGAACAGCTGTGCATCAACTATACCAACGAG
AAGCTGCAACAGTTTTTCAACCACCATATGTTCGTCTTAGAACAAGAGGAATACGCACGAGAGCAAATTGAGTGG
CAATTCATTGACTTCGGAAAGGACTTGCAACCAACAATTGACCTAATCGAGTTGACCAATCCTATTGGTATCTTT
TCGTGTCTAGATGAAGATTCTGTTATGCCGAAGGCTACAGACAAATCTTTTACTGAAAAGCTGCACTCGCTCTGG
GATCGGAAATCACCGAAGTATCGTGCTTCTCGGCTAAGCCAGGGATTCGTTCTGACGCACTACGCTGCTGAGGTA
GAGTATGGCACAGAGGGCTGGCTCGAGAAGAACAAGGACCCACTGAACGATAACATAACGCGACTGCTTGCAAGA
TCAGGTGAAAAACATGTCGCGACTCTGTTCTCCGACTGCGGCGACGCCGACGATGACAGCGACTACCCTAAGAGT
CGCGTGAAGAAGGGTCTCTTCCGCACCGTTGCGCAAAGACATAAGGAACAACTATCTAGCCTCATGAATCAGCTG
AACTCAACGCATCCTCACTTTGTGCGCTGTATTATACCCAACCACAAAAAGCGCCCGAAGATGTTCAACGCACCC
CTGGTCCTCGATCAGCTACGTTGCAACGGTGTACTCGAAGGAATACGAATTGCACGCACTGGGTTCCCTAATCGG
CTGTCATTTTCGGAATTCCGTCAACGCTACGAAGTTCTCTGCCCTGCCATGCCCAAGGGATACCTCGACGGCCGG
AATGCCGCTCATGTTATGTTGCAAAAGCTCGGGCTGGACCCTGCTTGGTATCGAGTCGGTCGTACGAAGGTATTC
TTCAGGGCAGGGGTCCTGGCCGAGTTGGAAGAGAAACGAGATCAGCTTATTCGCACCATCATGACCCGGTTCCAA
TCTGTGGCAAGGGGATTTGTCCAGCGGCGTATCTCCAACAAGCGCTTGTATCGGGCGGAAGCAACACGGATCATT
CAGGACAACTTCAAGTCTTACCTCCAGTTGAAAGCGAACCCATGGTGGAGACTGTATTCCAGGATGAGGCCTCTT
CTGGGAGAAACTCGCACTGCCAATGAAGTCAAAAGGCGGGACGAGAAGATCAAGTCCCTGGAAGCGAAGATGAAC
CAGGATATAGCTGATCGACAGAAGCTAGAGGAAGAGAGGCGTCGTACCGAGATTGAAATACAGAAGATTCAACAA
ACGTTGGAGAGTGAGCGTGCCTTGGCTCTCGACAAGGAGGAGATATTCAAGAGACTGCAAGTCCGAGAAGTTGAG
CTTAGTGAGAAGTTGGCCGGTGCTATCGCAGACCAGGAGAGCCTCGAAGACCAACTAGATGATCTGATAGCTGCC
AAGAAAAGAACGGATGACGAGCTTGAGCTCCGCATAACCCAACTTGAACAGGCAGGAGAAATCATCCAACGCTTT
GAGAACGAAAAGCATGAGATGCAGGCACGTCTAGAAGAACTCGAGAAGAAGCTGGCCGAGGCAGAAAGCTCTTCC
CTGGAGAAGGAGGCCAAGATCAAGGAGCTGGGCCAAGAGTTAAAGATGTTGCAGAGTCACCTCAGCTTGAAAGAG
CGCAAACTGCAAGATCTAGAGACCAAACTCTTGAAGACTGATCAAGATCTTGAAGTTAAGCTCTCCAAGACCTCG
AGAGACCTAGACCAGTCCAAGAAACACATCAAAGAGCTCATTGAAGAAAATCGGGTCATAAGACAACAAATCACC
GACCTCTCCTCAACATCCACTGGCTACGAAGAGATGCTTAGGCGAAAGGAAAGCGAAATGGCTGTTCTGCGAAAC
GATGCCAAGAAGCATGAAGAGGAGAAAAGATATCTAGAGTCGGAGAAGGTTTCTCTTACTACGCGACATGACAGC
ATGCAGGAGCGTCTACGAGAGCTGCAAGCTGAGGTAGACGCGATGAGGTCAGAGAAGGTTCAGCTTGAGCGAGAG
GCGGCCGATGTCAAGAAGCTACTGGAGGCAAAGATATCAGAGGATGCCGAGGCTGGCGAAAGCCGAAAGCTTCTC
GAGCAGCAAATCCAAGAATTGAAAAATCAACTCTTCAAAGCACAGGCTGATTTGAGCCGGGAGCGTCAATCGCGT
GATGATGTGCAAATGCTTGCCGAGCATAATCTCGCGGAGCTCAAGGACAAGTACACTTCCTTGAATGAATCAAAG
ATTATCATCGAAAAGGAGATGTACATTCAGCAGGACACTCTTCGTCGTGCCACGGAAGCCCGCGTTGCTGCTGAG
CAGTCACGCAAGGAACTTCAAACTGAATTGATTCAACTTCGGGACCGCTTCACGAAGGTCGAGGATGCGCGATTA
AACGCAGAGGACGACATTGAGCGCAACATCATGAAGCAGGCCAACGAGCGTCTTGAGAGTGTGCGCAAAGACCTG
GATGATAAGACACGCCAGCTGGAAGAGGTAGAAGCTGAAAGGTCACGTCTTTCCACCAGAATTCAAGAATTGACC
CACGCTATCGCTGAATCTGACAATTTCCGCATTCGCCATGATCAACATAAGGAACGCCTGGAGAGGGAATTGGTG
ACGCTCAAGGGTAGGCTTACAGCATCGGAAAATGATAACCGAGCTCTCCTCACAAAGATCCAACAAAAGAACCTC
GACATAGCCCGATCAACTTCCAGGGCCAGTGACAACTCGCGCCTGCGCATAACTGCTCTCCAGAAAGAAAAGACG
AAGCTCGAAGAGGACAACAAGAAAATAACCCGTCAGCTTGGCGATCTGCAAGTCAACATCACTTCTCTGGAGAAG
CAGAAAGAGAAGTTGTCTTTGAGCCTGGAGGACCTTAACCACGAGGTTGCTAGAGAACACAAGGCCAGTCGGAAT
GCGGAAAAGGCTGCTTCCACTGCCAACATCCAATTGGCGGAGGCGAACAGGAACCTTGAGACCGAAAGACAGCTC
CGGACCCAGGCACAAGCAAATACGCGCAAGCTTCAAGGCTCCCTGGATACGGCAAACAAGGAGATCGAAGATCTA
CACCGCCAATTGATGTTGCTGCACAAGGTAGTGGAGCCTGAGTCTGATGAATCGGAATCCTGGGAGAAGGTCCAG
CCTAGTCTGGCTAAGAAGGTTGATTTGGCACAATTGTTACAGACGACACAGAGTAGGTTGCAAGTCACCGAGGAG
AAGTATAGTCGAGCCGAGGCCCAATTGGCGGAAATGCGTCGTCGGCATGGGGATGAAATGAAGGAGCTGGATGCA
CGTTACGCCTCATCTAAACGCGCCTTGCTCGAGGAGATCGACCAGAACCAGGTAGCTAGCCCTCGGACCCCTACT
CACCTCAGAAAGAACTCCGACAATGTTCTGGCAAAGAAGTTCGGCACTCCTACAACGCCTAACCGTAGGCTTAAC
TTCAATGAAACGGCAAATGACTCTGCTCGATCTGACAGAACCGTGGATACTGTCGGCTACCAAAAGCGAATGGAT
CTGGCGGCCGAAATTGAGGAGCTGCAGAACAAGCTTCAAATGAGCGAAATGCAGAACAAACATCTCCAAAACCAG
CTTTCCCAAGCAGCACCTGGTCGTGATATGTGGCAGGAAGAAAGTCCTTCTCTTCGACGCATGCAGCTGCTTGAA
CGTGAGAACGGACGTCTACACGAGCAGCTCGATGACTCCTCTAAGAAGGTTTCTGCTCTTGAGAAGAACATTCGG
TCAGGTGATCTTTCACTGCGGGACGTCCAAGCCAAATCGCATGAAGAACTGTACGACCTAATCAACTCGCAGGAG
CAGTCCAGAAGGTCTTTGCTCAAGGTGCACAACGAAGCCATTGCAGAGTTCAGCGACGCCAAAGCTCAATTCGAA
AAGCTTAAGAGGGCTAAGGCTACGCTGGAAGTAGAACTCCGTGATGCCCGTTCCGAGTTCCAGGAGCTGCAGGTC
GCAAGGGACCAGGATGCTGTTAGTCGGAATCAGCTTCTTCAGGAGTTTTCTGACCTTCAAATCCGCTTGGATGCA
GAGACCTCGAAGTCAGCTGATTTGGCTTCCAGTATGAGCTTGTACAAGACCCGTGCCGATGAGTATTTCAGCAAA
CTGGAACAAGCTGAGATTGCAGTTCTGAAGGCTACTCGAGCAGAGCAATTCGCCAAATCCCAGGCCCAGGAGGCT
GAGGATACCTGTGCTCAGATAATGTCTGAGCGCAAACAAATGGATGCCCTGGTTGAAGACCTGCAACGTCAAACT
CAGTCGCTCGAGGCCAGAATGGAAGATCAAGCAGCTGAGCTCCAAGGTGCACTCCAGGCCAAACAGCGTCTCCAA
AACGAGCTTGAAGACTACAGAAACCAACGTGCCATTGATATTGAGGACAAGGAGACTTCAATGGAACAGACTAGG
CAAAAGTATCAGCGCGAATTTACCACGCTCAACAACGAATTGGAGATGGAGCGTGAAAAGGTCCTCAATGTTCGC
GGTGAGAACTCACGCCTCCGTGAAGAACTTGAAGACTTGCGGAGCAAGTGGGACAATGAAGTCTTGAACAGCTCT
ACTTGGGCTAAGGAGAAGGCTCGAATGGACATCATGCTTCAAGACGTGACGACATCTCGTGATGAGGCAGTGAAT
GCTCATAATGAAGCTCAAAGCAGGGTTGTCTCCCTCCTGTCCCAGGTGAGAACTCTTCGCACCTCCGTCGACGAC
GTGACCGCGGAGCGCGACATGCTGCTCAAGGAGAAGAAGATGCTGGAAACCCGGTTAGCTGAGGCAGGTGAAAGG
CTGGAGGATCTCGCCAAGGGCGAGAGTCCATCAATGCGCAATGCTGCAAGCATGGACCGTGAGTTGTTGGAACTT
AAGTCCAAGCTTGCTCAACAGGAAGATGTTTCCGCAGCTGCAGTTGGTAAGATGAGGCGGGCGGAAGCATTGGCG
ACGGAGATGCAGAAGGAAGTCACTGCTGAGAGAGAAACAAATGCTCAGCTCTTCAAGGACAAGGCGGCCCTCGAA
AAGCAGCTGAAGGAATCTCAACTTCGTTGCGTTGATCTCGAGACCAAGAGCTACTCATCTGGAAGCCAGGACGTC
CGATTCTTACACAAGAGAATCAAGGAACTGGAAACCCATCTGGAGGACCAAGAAGCCAAGCACAGTTCCGAGCAA
CGTTCGTTGCGGAATGTCGACCGCACGGTTAAAGACCTGCAGTCCCAGATCGAGCGCAGGGATAAGATGAATTCC
CAGCTCAATGACGACGTCAGCAAAGCTCGCGACAAGATCGAGCGTCTTCTTCGGAACATCGAGGAGCTTCAGCAC
ACCGACTCGGAGACACAGCTGCAAGTGCGCCGAGCAGAGCGAGAACTCCGGGAAGAGCGGGAGAAGTCTCTCAGG
CTGGAACGTGAACTAGAGGGATGGCGAGCGCTCCGGGTTGAGAGGGGCAGCGTCCTCGGACGTAGCCACGTCGGC
GCTTTCAGCGACGCCGGAAGCAGGAGAGGGAGCAGCGTGTACGGAGGCGATATACCGCAGCGGATGCCTAGCAAC
ACCAAAGGCTTCTTGGCCTGA
Gene >Ani_SJS14_1|g6012.t1
ATGCTTCCATCACAGTTAAATGGCTCCCCTAAGCGGGCCAACCCTTTCAGCCGCGCATCGCCGTCACCGACTCCC
TCCCCAACTCAGCAGACAAGAGGTATTCGCCCCAAGTCGGCCGTTGTTACATCCCCCAGTAAATTCGAAGAGGCC
CGGGGCCATTTTCGAAACTCTGCTTCCATCTCACAGTCACCATCACCGTTGGTGGCACGGACAACGCATCGGCCG
AGGTCGAGCTCAATAAGGAATGATGTTTCATCAGGAACCTTTGCGCCCGAATTCATCAAGTCGGAGGAGCTACGC
AGGGGTGCGGATCAGATCCGGGGACAAGAGGGCGACAATGACTTCTCCGGCAACAAGTATGTCTGGCTCCGCGAT
ACCGAAAAGGCATTCGTGCGTGGGCTTGTTCTCGAAGAGCAAGAAGGTGGCCGGATGTTAGTCCAGACCGACAAT
GGAGAGGTATAATCACCCAAAGGCATCGGAGACTGAGCTAGAAAGGCTTACGGATAAACACAGCAAAGGGAGGTC
GACGCTGACCAAGTCGACAAAGTGAACCCGGCGAAGTTTGATAAGGCAGATGATATGGCTGAACTCACACATCTA
AATGAAGCCTCAGTGGTTCACAATCTGCACACCCGATATCAAGCCGATCTCATCTATGTAAGTGTTACCGATTTA
CGGACCAATTGATAGGCATTAAGAGCTAATCCTTGCCCTTCACAGACGTACTCCGGACTTTTCCTCGTTACTGTG
AACCCATACTGCCCATTGCCAATCTACACAAACGAGTATGTGAAGATGTACAAGGGTCGTAACAGAGAAGAGAGC
CGTCCCCACATCTTTGCTATGGCTGATGAGGCCTTTCGAAATCTGGTCGAAGAAGGAGAGAACCAAAGCATTCTC
GTGACGTAAGTCTACTGAAAGGCCAGTCACAGATTCAGGACACTAATTCGACCCTAAAGGGGAGAGTCAGGTGCA
GGTAAAACCGAGAACACCAAGAAGGTTATACAATACCTTGCAGCTGTTGCGACAACCGACACCCCTTACGCTCGA
TCTGGCACTAAGCAATTGTCCGCCCTGTCCCAACAGATTCTGAGGGCAAACCCCATTCTGGAGGCGTTTGGAAAT
GCCCAGACCGTCAGGAACAACAACTCTTCCCGCTTTGGCAAGTTCATTCGTATTGAGTTCACCCGGGCCGGCCAG
ATATCGGGTGCTTCGATCGATTGGTATCTACTGGAGAAGTCTCGTGTCGTGAAACCCAATTCGCATGAAAGAAAC
TACCATATCTTCTACCAGTTATTACGGGGAGCAGACCGAAAGCTTAGGGAGGCTCTCCTTTTGTCCGACTTGCAG
ATTGAGGATTTCGCCTATACTCGTGATGGTAACGACACCATTGCTGGGGTCTCTGATGAGGACGAATGGAAAATG
TTGATTGAGGCTTTCCATGTTATGGACTTTTCCGAGGAAGACCAGATGTGCATCTTGCGCACTATCGCAGCAGTC
CTTCATCTGGGAAATATCACCATCGTCAAGGAAAGCCTACGAGCCGATCAAGCTGCACTTGGCCCCGACTCCCTG
AACAGTGTAGAGAGGGCTTGCCACTTGCTAGGTATAGAACCTGAGCTATTCGTCAAAGGACTGCTGCATCCCAAG
GTCAAAGCAGGCCGCGAGTGGGTGGAAAAGGTTCAAACGCCAGAACAGGTTCGACTAGCACTCGATGCTCTCGCC
AAGGGTATCTATGAACGAGGATTTAGCAATCTTGTCGACAGAATCAACAACCAGCTGGACCGCAGCACTGTCGCT
GGCGATGACAGCTTCTTCATCGGAGTCCTCGATATTGCGGGTTTCGAGATTTTCAAGAACAACAGCTTCGAACAG
CTGTGCATCAACTATACCAACGAGAAGCTGCAACAGTTTTTCAACCACCATATGTTCGTCTTAGAACAAGAGGAA
TACGCACGAGAGCAAATTGAGTGGCAATTCATTGACTTCGGAAAGGACTTGCAACCAACAATTGACCTAATCGAG
TTGACCAATCCTATTGGTATCTTTTCGTGTCTAGATGAAGATTCTGTTATGCCGAAGGCTACAGACAAATCTTTT
ACTGAAAAGCTGCACTCGCTCTGGGATCGGAAATCACCGAAGTATCGTGCTTCTCGGCTAAGCCAGGGATTCGTT
CTGACGCACTACGCTGCTGAGGTAGAGTATGGCACAGAGGGCTGGCTCGAGAAGAACAAGGACCCACTGAACGAT
AACATAACGCGACTGCTTGCAAGATCAGGTGAAAAACATGTCGCGACTCTGTTCTCCGACTGCGGCGACGCCGAC
GATGACAGCGACTACCCTAAGAGTCGCGTGAAGAAGGGTCTCTTCCGCACCGTTGCGCAAAGACATAAGGAACAA
CTATCTAGCCTCATGAATCAGCTGAACTCAACGCATCCTCACTTTGTGCGCTGTATTATACCCAACCACAAAAAG
CGCCCGAAGATGTTCAACGCACCCCTGGTCCTCGATCAGCTACGTTGCAACGGTGTACTCGAAGGAATACGAATT
GCACGCACTGGGTTCCCTAATCGGCTGTCATTTTCGGAATTCCGTCAACGCTACGAAGTTCTCTGCCCTGCCATG
CCCAAGGGATACCTCGACGGCCGGAATGCCGCTCATGTTATGTTGCAAAAGCTCGGGCTGGACCCTGCTTGGTAT
CGAGTCGGTCGTACGAAGGTATTCTTCAGGGCAGGGGTCCTGGCCGAGTTGGAAGAGAAACGAGATCAGCTTATT
CGCACCATCATGACCCGGTTCCAATCTGTGGCAAGGGGATTTGTCCAGCGGCGTATCTCCAACAAGCGCTTGTAT
CGGGCGGAAGCAACACGGATCATTCAGGACAACTTCAAGTCTTACCTCCAGTTGAAAGCGAACCCATGGTGGAGA
CTGTATTCCAGGATGAGGCCTCTTCTGGGAGAAACTCGCACTGCCAATGAAGTCAAAAGGCGGGACGAGAAGATC
AAGTCCCTGGAAGCGAAGATGAACCAGGATATAGCTGATCGACAGAAGCTAGAGGAAGAGAGGCGTCGTACCGAG
ATTGAAATACAGAAGATTCAACAAACGTTGGAGAGTGAGCGTGCCTTGGCTCTCGACAAGGAGGAGATATTCAAG
AGACTGCAAGTCCGAGAAGTTGAGCTTAGTGAGAAGTTGGCCGGTGCTATCGCAGACCAGGAGAGCCTCGAAGAC
CAACTAGATGATCTGATAGCTGCCAAGAAAAGAACGGATGACGAGCTTGAGCTCCGCATAACCCAACTTGAACAG
GCAGGAGAAATCATCCAACGCTTTGAGAACGAAAAGCATGAGATGCAGGCACGTCTAGAAGAACTCGAGAAGAAG
CTGGCCGAGGCAGAAAGCTCTTCCCTGGAGAAGGAGGCCAAGATCAAGGAGCTGGGCCAAGAGTTAAAGATGTTG
CAGAGTCACCTCAGCTTGAAAGAGCGCAAACTGCAAGATCTAGAGACCAAACTCTTGAAGACTGATCAAGATCTT
GAAGTTAAGCTCTCCAAGACCTCGAGAGACCTAGACCAGTCCAAGAAACACATCAAAGAGCTCATTGAAGAAAAT
CGGGTCATAAGACAACAAATCACCGACCTCTCCTCAACATCCACTGGCTACGAAGAGATGCTTAGGCGAAAGGAA
AGCGAAATGGCTGTTCTGCGAAACGATGCCAAGAAGCATGAAGAGGAGAAAAGATATCTAGAGTCGGAGAAGGTT
TCTCTTACTACGCGACATGACAGCATGCAGGAGCGTCTACGAGAGCTGCAAGCTGAGGTAGACGCGATGAGGTCA
GAGAAGGTTCAGCTTGAGCGAGAGGCGGCCGATGTCAAGAAGCTACTGGAGGCAAAGATATCAGAGGATGCCGAG
GCTGGCGAAAGCCGAAAGCTTCTCGAGCAGCAAATCCAAGAATTGAAAAATCAACTCTTCAAAGCACAGGCTGAT
TTGAGCCGGGAGCGTCAATCGCGTGATGATGTGCAAATGCTTGCCGAGCATAATCTCGCGGAGCTCAAGGACAAG
TACACTTCCTTGAATGAATCAAAGATTATCATCGAAAAGGAGATGTACATTCAGCAGGACACTCTTCGTCGTGCC
ACGGAAGCCCGCGTTGCTGCTGAGCAGTCACGCAAGGAACTTCAAACTGAATTGATTCAACTTCGGGACCGCTTC
ACGAAGGTCGAGGATGCGCGATTAAACGCAGAGGACGACATTGAGCGCAACATCATGAAGCAGGCCAACGAGCGT
CTTGAGAGTGTGCGCAAAGACCTGGATGATAAGACACGCCAGCTGGAAGAGGTAGAAGCTGAAAGGTCACGTCTT
TCCACCAGAATTCAAGAATTGACCCACGCTATCGCTGAATCTGACAATTTCCGCATTCGCCATGATCAACATAAG
GAACGCCTGGAGAGGGAATTGGTGACGCTCAAGGGTAGGCTTACAGCATCGGAAAATGATAACCGAGCTCTCCTC
ACAAAGATCCAACAAAAGAACCTCGACATAGCCCGATCAACTTCCAGGGCCAGTGACAACTCGCGCCTGCGCATA
ACTGCTCTCCAGAAAGAAAAGACGAAGCTCGAAGAGGACAACAAGAAAATAACCCGTCAGCTTGGCGATCTGCAA
GTCAACATCACTTCTCTGGAGAAGCAGAAAGAGAAGTTGTCTTTGAGCCTGGAGGACCTTAACCACGAGGTTGCT
AGAGAACACAAGGCCAGTCGGAATGCGGAAAAGGCTGCTTCCACTGCCAACATCCAATTGGCGGAGGCGAACAGG
AACCTTGAGACCGAAAGACAGCTCCGGACCCAGGCACAAGCAAATACGCGCAAGCTTCAAGGCTCCCTGGATACG
GCAAACAAGGAGATCGAAGATCTACACCGCCAATTGATGTTGCTGCACAAGGTAGTGGAGCCTGAGTCTGATGAA
TCGGAATCCTGGGAGAAGGTCCAGCCTAGTCTGGCTAAGAAGGTTGATTTGGCACAATTGTTACAGACGACACAG
AGTAGGTTGCAAGTCACCGAGGAGAAGTATAGTCGAGCCGAGGCCCAATTGGCGGAAATGCGTCGTCGGCATGGG
GATGAAATGAAGGAGCTGGATGCACGTTACGCCTCATCTAAACGCGCCTTGCTCGAGGAGATCGACCAGAACCAG
GTAGCTAGCCCTCGGACCCCTACTCACCTCAGAAAGAACTCCGACAATGTTCTGGCAAAGAAGTTCGGCACTCCT
ACAACGCCTAACCGTAGGCTTAACTTCAATGAAACGGCAAATGACTCTGCTCGATCTGACAGAACCGTGGATACT
GTCGGCTACCAAAAGCGAATGGATCTGGCGGCCGAAATTGAGGAGCTGCAGAACAAGCTTCAAATGAGCGAAATG
CAGAACAAACATCTCCAAAACCAGCTTTCCCAAGCAGCACCTGGTCGTGATATGTGGCAGGAAGAAAGTCCTTCT
CTTCGACGCATGCAGCTGCTTGAACGTGAGAACGGACGTCTACACGAGCAGCTCGATGACTCCTCTAAGAAGGTT
TCTGCTCTTGAGAAGAACATTCGGTCAGGTGATCTTTCACTGCGGGACGTCCAAGCCAAATCGCATGAAGAACTG
TACGACCTAATCAACTCGCAGGAGCAGTCCAGAAGGTCTTTGCTCAAGGTGCACAACGAAGCCATTGCAGAGTTC
AGCGACGCCAAAGCTCAATTCGAAAAGCTTAAGAGGGCTAAGGCTACGCTGGAAGTAGAACTCCGTGATGCCCGT
TCCGAGTTCCAGGAGCTGCAGGTCGCAAGGGACCAGGATGCTGTTAGTCGGAATCAGCTTCTTCAGGAGTTTTCT
GACCTTCAAATCCGCTTGGATGCAGAGACCTCGAAGTCAGCTGATTTGGCTTCCAGTATGAGCTTGTACAAGACC
CGTGCCGATGAGTATTTCAGCAAACTGGAACAAGCTGAGATTGCAGTTCTGAAGGCTACTCGAGCAGAGCAATTC
GCCAAATCCCAGGCCCAGGAGGCTGAGGATACCTGTGCTCAGATAATGTCTGAGCGCAAACAAATGGATGCCCTG
GTTGAAGACCTGCAACGTCAAACTCAGTCGCTCGAGGCCAGAATGGAAGATCAAGCAGCTGAGCTCCAAGGTGCA
CTCCAGGCCAAACAGCGTCTCCAAAACGAGCTTGAAGACTACAGAAACCAACGTGCCATTGATATTGAGGACAAG
GAGACTTCAATGGAACAGACTAGGCAAAAGTATCAGCGCGAATTTACCACGCTCAACAACGAATTGGAGATGGAG
CGTGAAAAGGTCCTCAATGTTCGCGGTGAGAACTCACGCCTCCGTGAAGAACTTGAAGACTTGCGGAGCAAGTGG
GACAATGAAGTCTTGAACAGCTCTACTTGGGCTAAGGAGAAGGCTCGAATGGACATCATGCTTCAAGACGTGACG
ACATCTCGTGATGAGGCAGTGAATGCTCATAATGAAGCTCAAAGCAGGGTTGTCTCCCTCCTGTCCCAGGTGAGA
ACTCTTCGCACCTCCGTCGACGACGTGACCGCGGAGCGCGACATGCTGCTCAAGGAGAAGAAGATGCTGGAAACC
CGGTTAGCTGAGGCAGGTGAAAGGCTGGAGGATCTCGCCAAGGGCGAGAGTCCATCAATGCGCAATGCTGCAAGC
ATGGACCGTGAGTTGTTGGAACTTAAGTCCAAGCTTGCTCAACAGGAAGATGTTTCCGCAGCTGCAGTTGGTAAG
ATGAGGCGGGCGGAAGCATTGGCGACGGAGATGCAGAAGGAAGTCACTGCTGAGAGAGAAACAAATGCTCAGCTC
TTCAAGGACAAGGCGGCCCTCGAAAAGCAGCTGAAGGAATCTCAACTTCGTTGCGTTGATCTCGAGACCAAGAGC
TACTCATCTGGAAGCCAGGACGTCCGATTCTTACACAAGAGAATCAAGGAAGTAAGTTGCCCCATATATATGCTA
AACTCGTCGTCACCATGAAGGATGCTAACAGTTCTCAAACTAGCTGGAAACCCATCTGGAGGACCAAGAAGCCAA
GCACAGTTCCGAGCAACGTTCGTTGCGGAATGTCGACCGCACGGTTAAAGACCTGCAGTCCCAGATCGAGCGCAG
GGATAAGATGAATTCCCAGCTCAATGACGACGTCAGCAAAGCTCGCGACAAGATCGAGCGTCTTCTTCGGAACAT
CGAGGAGCTTCAGCACACCGACTCGGAGACACAGCTGCAAGTGCGCCGAGCAGAGCGAGAACTCCGGGAAGAGCG
GGAGAAGTCTCTCAGGCTGGAACGTGAACTAGAGGGATGGCGAGCGCTCCGGGTTGAGAGGGGCAGCGTCCTCGG
ACGTAGCCACGTCGGCGCTTTCAGCGACGCCGGAAGCAGGAGAGGGAGCAGCGTGTACGGAGGCGATATACCGCA
GCGGATGCCTAGCAACACCAAAGGCTTCTTGTAAGAATATGACGACCTAGCAGGTTGACCCTGCTGAGCACATGG
CTCTATCTAAACTCAGGCGCTAAACATTCATTTAGGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail