Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS115_1|g920.t1
Gene name
Locationscaffold_004:79584..81217
Strand-
Gene length (bp)1633
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11931 SF3a60_Prp9_C SF3a60/Prp9 C-terminal 4.0E-54 385 505
PF16837 SF3A3 Pre-mRNA-splicing factor SF3A3, of SF3a complex, Prp9 3.2E-16 126 170
PF12108 SF3a60_bindingd Splicing factor SF3a60 binding domain 3.3E-15 72 98
PF12874 zf-met Zinc-finger of C2H2 type 1.3E-06 253 276
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 1.0E-07 253 276

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0005681 spliceosomal complex Yes
GO:0003723 RNA binding Yes
GO:0043170 macromolecule metabolic process No
GO:0008380 RNA splicing No
GO:0016071 mRNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0006397 mRNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0140513 nuclear protein-containing complex No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0006396 RNA processing No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0016070 RNA metabolic process No
GO:0003674 molecular_function No
GO:1990904 ribonucleoprotein complex No
GO:0032991 protein-containing complex No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0090304 nucleic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup1577
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g1287.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g9265.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g2322.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g9176.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g8527.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g2211.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g4084.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g2777.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g2141.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g290.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7449.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g6663.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g88.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g920.t1 (this protein)
Aspergillus niger CBS 147344 Ani_SJS70_1|g3701.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g4742.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g7544.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g4779.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g5364.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g1276.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g25.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g8033.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g8516.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g349.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS115_1|g920.t1
MIFEEQRFIHEDLERLEQAIADRVAEEPRNIRDRLARDHEVAHFLKRIEDQSKRLLDIYKDADGAREKEIQTIST
GDQFEEFYKQLDEIKDFHKRYPNEPVENLERAYKRRQPGEGEVTGMEIDNLFTGEEGYGQFLDLTTLHEDYLNLP
GVKRLSYVQYLDIFDAFTPPQLPIKRNNKLSDRYFKYVGELANYLESFIKKVKPLQDLDKLFASFDEEFEKQWTA
NQVPGWTEEVAENGNQGPKTEGSGEGIWCADCEREFKNENVYKNHLTGKKHIRAAEARKAAGDTGAKPAAPATNG
ASSVAHRLKERAVAEREHRVRSLTQVLQPERVATRMNVERRQGMTERERQMELEALLNESENPGGDRAGDQSDED
DEDRIYNPLKLPLAWDGKPIPYWLYKLHGLGVEYPCEICGNFVYMGRRAFDKHFSEALHIFGLKCLGITSNTNLF
REITRIEDAIRLWEKLEQDRKKDRDNRDNVVQMEDAEGNVMPERIYLDLQKQGIL*
Coding >Ani_SJS115_1|g920.t1
ATGATTTTCGAGGAGCAACGGTTTATCCACGAGGACCTTGAGCGCCTAGAGCAGGCGATTGCCGACCGCGTTGCC
GAAGAGCCTCGTAATATTCGGGATCGCTTGGCTCGCGATCATGAAGTCGCACATTTCTTAAAGCGTATAGAAGAC
CAGTCCAAGAGGTTGCTCGACATCTACAAGGATGCAGACGGCGCGCGTGAGAAGGAAATCCAAACCATCTCAACC
GGCGATCAATTCGAGGAGTTCTACAAGCAACTGGATGAGATCAAGGACTTCCATAAGCGCTACCCTAATGAGCCA
GTGGAAAACCTTGAACGGGCTTATAAGCGTCGTCAGCCCGGAGAGGGTGAAGTAACGGGCATGGAGATCGACAAT
CTATTCACCGGTGAAGAGGGTTATGGACAGTTTCTGGACCTCACAACACTGCACGAAGACTACCTCAATTTGCCT
GGGGTCAAACGGCTCTCATATGTGCAATACCTCGACATATTCGATGCGTTTACTCCTCCGCAACTTCCGATTAAG
CGAAACAACAAACTTTCCGATCGGTATTTCAAGTATGTCGGCGAACTTGCAAACTACTTGGAAAGCTTCATCAAG
AAAGTGAAGCCGTTACAAGATCTGGACAAACTTTTTGCTAGCTTTGATGAGGAGTTCGAGAAGCAATGGACGGCG
AATCAGGTACCTGGTTGGACGGAGGAGGTTGCTGAAAATGGTAACCAAGGTCCGAAGACCGAGGGCTCCGGAGAA
GGCATCTGGTGTGCTGACTGCGAGAGGGAATTCAAGAATGAGAATGTCTATAAGAATCACTTGACAGGCAAAAAG
CACATCCGGGCCGCTGAAGCTCGCAAAGCTGCCGGGGATACTGGCGCGAAACCGGCAGCCCCTGCGACGAACGGC
GCATCATCCGTGGCTCATCGTCTTAAGGAACGTGCAGTCGCAGAGAGGGAACATCGGGTGCGTTCTCTGACGCAG
GTACTGCAGCCCGAGCGTGTAGCGACGAGGATGAACGTGGAGCGGAGACAGGGTATGACTGAACGGGAGCGCCAA
ATGGAACTTGAAGCTCTGCTTAATGAGTCTGAGAACCCTGGCGGTGATCGTGCTGGCGATCAATCTGACGAGGAC
GACGAAGACCGAATCTACAATCCCCTCAAACTGCCACTTGCTTGGGACGGCAAGCCAATTCCCTACTGGCTTTAC
AAGCTGCATGGCCTGGGGGTAGAGTATCCTTGCGAGATCTGCGGTAACTTTGTGTATATGGGCCGTCGAGCTTTT
GACAAGCATTTCTCAGAGGCCCTACATATCTTTGGTTTGAAGTGTCTTGGTATCACTTCTAATACCAACCTTTTC
CGTGAAATCACTCGGATTGAGGATGCAATCAGGCTTTGGGAGAAATTAGAGCAGGACCGCAAGAAGGATAGAGAT
AATCGCGACAATGTGGTACAGATGGAGGACGCCGAAGGCAATGTGATGCCGGAGAGGATCTACCTTGATCTGCAA
AAGCAAGGTATACTGTAA
Transcript >Ani_SJS115_1|g920.t1
ATGATTTTCGAGGAGCAACGGTTTATCCACGAGGACCTTGAGCGCCTAGAGCAGGCGATTGCCGACCGCGTTGCC
GAAGAGCCTCGTAATATTCGGGATCGCTTGGCTCGCGATCATGAAGTCGCACATTTCTTAAAGCGTATAGAAGAC
CAGTCCAAGAGGTTGCTCGACATCTACAAGGATGCAGACGGCGCGCGTGAGAAGGAAATCCAAACCATCTCAACC
GGCGATCAATTCGAGGAGTTCTACAAGCAACTGGATGAGATCAAGGACTTCCATAAGCGCTACCCTAATGAGCCA
GTGGAAAACCTTGAACGGGCTTATAAGCGTCGTCAGCCCGGAGAGGGTGAAGTAACGGGCATGGAGATCGACAAT
CTATTCACCGGTGAAGAGGGTTATGGACAGTTTCTGGACCTCACAACACTGCACGAAGACTACCTCAATTTGCCT
GGGGTCAAACGGCTCTCATATGTGCAATACCTCGACATATTCGATGCGTTTACTCCTCCGCAACTTCCGATTAAG
CGAAACAACAAACTTTCCGATCGGTATTTCAAGTATGTCGGCGAACTTGCAAACTACTTGGAAAGCTTCATCAAG
AAAGTGAAGCCGTTACAAGATCTGGACAAACTTTTTGCTAGCTTTGATGAGGAGTTCGAGAAGCAATGGACGGCG
AATCAGGTACCTGGTTGGACGGAGGAGGTTGCTGAAAATGGTAACCAAGGTCCGAAGACCGAGGGCTCCGGAGAA
GGCATCTGGTGTGCTGACTGCGAGAGGGAATTCAAGAATGAGAATGTCTATAAGAATCACTTGACAGGCAAAAAG
CACATCCGGGCCGCTGAAGCTCGCAAAGCTGCCGGGGATACTGGCGCGAAACCGGCAGCCCCTGCGACGAACGGC
GCATCATCCGTGGCTCATCGTCTTAAGGAACGTGCAGTCGCAGAGAGGGAACATCGGGTGCGTTCTCTGACGCAG
GTACTGCAGCCCGAGCGTGTAGCGACGAGGATGAACGTGGAGCGGAGACAGGGTATGACTGAACGGGAGCGCCAA
ATGGAACTTGAAGCTCTGCTTAATGAGTCTGAGAACCCTGGCGGTGATCGTGCTGGCGATCAATCTGACGAGGAC
GACGAAGACCGAATCTACAATCCCCTCAAACTGCCACTTGCTTGGGACGGCAAGCCAATTCCCTACTGGCTTTAC
AAGCTGCATGGCCTGGGGGTAGAGTATCCTTGCGAGATCTGCGGTAACTTTGTGTATATGGGCCGTCGAGCTTTT
GACAAGCATTTCTCAGAGGCCCTACATATCTTTGGTTTGAAGTGTCTTGGTATCACTTCTAATACCAACCTTTTC
CGTGAAATCACTCGGATTGAGGATGCAATCAGGCTTTGGGAGAAATTAGAGCAGGACCGCAAGAAGGATAGAGAT
AATCGCGACAATGTGGTACAGATGGAGGACGCCGAAGGCAATGTGATGCCGGAGAGGATCTACCTTGATCTGCAA
AAGCAAGGTATACTGTAA
Gene >Ani_SJS115_1|g920.t1
ATGATTTTCGAGGAGCAACGGTTTATCCACGAGGACCTTGAGCGCCTAGAGCAGGCGATTGCCGACCGCGTTGCC
GAAGAGCCTCGTAATGTAAGTAACTCTGCAGTCTCTATCTCGTCGCTCTCTGCTAACTCACTCCTTTACTTTCAG
ATTCGGGATCGCTTGGCTCGCGATCATGAAGTCGCACATTTCTTAAAGCGTATAGAAGACCAGTCCAAGAGGTTG
CTCGACATCTACAAGGATGCAGACGGCGCGCGTGAGAAGGAAATCCAAACCATCTCAACCGGCGATCAATTCGAG
GAGTTCTACAAGCAACTGGATGAGATCAAGGACTTCCATAAGCGCTACCCTAATGAGCCAGTGGAAAACCTTGAA
CGGGCTTATAAGCGTCGTCAGCCCGGAGAGGGTGAAGTAACGGGCATGGAGATCGACAATCTATTCACCGGTGAA
GAGGGTTATGGACAGTTTCTGGACCTCACAACACTGCACGAAGACTACCTCAATTTGCCTGGGGTCAAACGGCTC
TCATATGTGCAATACCTCGACATATTCGATGCGTTTACTCCTCCGCAACTTCCGATTAAGCGAAACAACAAACTT
TCCGATCGGTATTTCAAGTATGTCGGCGAACTTGCAAACTACTTGGAAAGCTTCATCAAGAAAGTGAAGCCGTTA
CAAGATCTGGACAAACTTTTTGCTAGCTTTGATGAGGAGTTCGAGAAGCAATGGACGGCGAATCAGGTACCTGGT
TGGACGGAGGAGGTTGCTGAAAATGGTAACCAAGGTCCGAAGACCGAGGGCTCCGGAGAAGGCATCTGGTGTGCT
GACTGCGAGAGGGAATTCAAGAATGAGAATGTCTATAAGAATCACTTGACAGGCAAAAAGCACATCCGGGCCGCT
GAAGCTCGCAAAGCTGCCGGGGATACTGGCGCGAAACCGGCAGCCCCTGCGACGAACGGCGCATCATCCGTGGCT
CATCGTCTTAAGGAACGTGCAGTCGCAGAGAGGGAACATCGGGTGCGTTCTCTGACGCAGGTACTGCAGCCCGAG
CGTGTAGCGACGAGGATGAACGTGGAGCGGAGACAGGGTATGACTGAACGGGAGCGCCAAATGGAACTTGAAGCT
CTGCTTAATGAGTCTGAGAACCCTGGCGGTGATCGTGCTGGCGATCAATCTGACGAGGACGACGAAGACCGAATC
TACAATCCCCTCAAACTGCCACTTGCTTGGGACGGCAAGCCAATTCCCTACTGGCTTTACAAGCTGCATGGCCTG
GGGGTAGAGTATCCTTGCGAGATCTGCGGTAACTTTGTGTATATGGGCCGTCGAGCTTTTGACAAGCATTTCTCA
GAGGCCCTACATATCTTTGGTTTGAAGTGTCTTGGTATCACTTCTAATACCAACCTTTTCCGTGAAATCACTCGG
ATTGAGGATGCAATCAGGCTTTGGGAGAAATTAGAGCAGGACCGCAAGAAGGATAGAGATAATCGCGACAATGTG
GTACAGATGGAGGACGCCGAAGGCAATGTGATGCCGGAGAGGATCTACCTTGAGTACGTGCCCCCAACAGTTCCG
CGGCCTAATGGAACCTTTACTAATGTTTACCAGTCTGCAAAAGCAAGGTATACTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail