Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS115_1|g8131.t1
Gene name
Locationscaffold_060:132533..134274
Strand+
Gene length (bp)1741
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 8.6E-15 188 464

GO

GO Term Description Terminal node
GO:0008194 UDP-glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016757 glycosyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 513 535 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT1 5.2E-25 141 463

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup9899
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g2361.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g7734.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g2222.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g1163.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g8246.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g1453.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g3592.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g4235.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g1330.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g1521.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g2983.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g3843.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g10064.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g8131.t1 (this protein)
Aspergillus niger CBS 147344 Ani_SJS70_1|g1333.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g7002.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g3748.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g10050.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g4459.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g9836.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g7214.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g9721.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g3257.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g5726.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS115_1|g8131.t1
MHHPERAAIYPNSAQHKAMSDIILPPRKILLVVTGGGYTHAAPVLELGKVLANRGHVVDFATLDGQEEWASGFQI
SSTHLMGPGPTEEQLDAHYMRSRLWNPARGLGDVMESKYLFDSLWTQSYHGLKTIMDDPATRPDMLLADFFVDAV
KDIQLEYKVPIAIVWPQMPYLMVPCSYIPGQPGFQLDMTLTSENASVWSRINNELVVVRALPEVLKLRNWTRAMR
KRAGLNYLLPTPKKPNYLLLVNSFFGLEVPKDLPPLVAAVGPILADEYPLLDAPYQEFLDRHPKTIYIALGTHII
LPHADARKILQGLIQAMEEGVIDGVIWSVGRSGRQLFDKAESFTVQGKTISFGDLLEGLHADWKFPFFAPQRSIL
DHPHTRIYFTHGGGSSANEGLYHGKPMLVMSFYFDQIGNAAKLAGSGTSELLHKFRFSADELYFKTKLIMEDRDG
GYARNVQRLQRIAHVASRRKYLGADLIEEVLYDTESRVIDGKETRPMHLQTADMRMPAYKAKNWDLMAVSGVVMG
LLGGGLYYAGRLAWINRRAIGGVVDGLVCKIYD*
Coding >Ani_SJS115_1|g8131.t1
ATGCATCATCCCGAGCGTGCGGCTATTTATCCCAACTCCGCCCAACACAAGGCTATGTCGGACATCATCCTGCCA
CCCAGGAAGATTCTCCTGGTAGTTACTGGAGGAGGCTACACCCATGCCGCCCCGGTTCTTGAACTGGGGAAGGTC
CTGGCCAACCGAGGGCACGTAGTCGACTTCGCAACGCTCGATGGCCAAGAGGAATGGGCCAGCGGCTTCCAGATC
TCGTCGACGCATCTCATGGGGCCTGGGCCGACAGAGGAACAGCTTGATGCGCACTACATGCGCAGCCGGCTCTGG
AATCCGGCCAGAGGTTTAGGCGATGTCATGGAGTCCAAGTACCTCTTCGACTCTCTGTGGACACAATCCTATCAT
GGACTGAAAACTATCATGGATGATCCTGCTACACGGCCGGACATGCTGCTTGCTGACTTCTTCGTCGACGCAGTC
AAGGATATCCAACTGGAATACAAGGTGCCCATTGCTATTGTCTGGCCACAGATGCCCTACTTGATGGTTCCCTGC
TCGTATATCCCCGGCCAGCCGGGCTTCCAACTCGATATGACCTTAACCTCGGAGAATGCGTCAGTATGGTCGCGC
ATCAACAATGAACTTGTAGTCGTGCGGGCCTTGCCTGAGGTGCTTAAACTGAGGAACTGGACCAGAGCCATGCGC
AAGCGAGCGGGTCTGAATTACCTTCTTCCAACGCCAAAGAAACCTAATTATCTACTTCTAGTCAACTCTTTCTTC
GGTCTCGAAGTGCCCAAAGACCTTCCTCCCTTGGTCGCAGCAGTCGGACCAATATTAGCAGATGAGTATCCTCTA
TTGGACGCGCCCTACCAGGAGTTCCTTGACCGCCACCCAAAGACCATATATATTGCCTTGGGCACGCATATCATC
CTTCCCCACGCAGATGCTCGGAAGATTCTTCAAGGACTTATCCAAGCCATGGAAGAAGGCGTTATTGACGGCGTA
ATCTGGTCAGTGGGTAGGAGCGGACGGCAGCTGTTCGACAAAGCGGAATCCTTCACTGTGCAAGGCAAGACAATT
AGCTTCGGAGACCTTCTCGAAGGGTTACACGCCGACTGGAAGTTCCCTTTCTTTGCACCACAACGGTCGATCCTG
GACCATCCCCATACCCGCATCTATTTCACCCACGGAGGTGGGTCCAGCGCCAACGAAGGCCTCTACCATGGCAAA
CCGATGCTAGTCATGTCATTCTACTTCGACCAGATCGGTAATGCGGCAAAACTGGCCGGAAGCGGAACGTCGGAG
CTGCTACACAAGTTCCGTTTCTCGGCCGATGAACTCTACTTCAAGACAAAATTGATCATGGAAGACCGTGACGGG
GGCTATGCGCGCAATGTGCAGCGTCTCCAGCGTATTGCCCATGTGGCGTCTCGACGCAAGTATTTGGGCGCTGAT
CTGATCGAGGAAGTTCTGTACGATACTGAGTCGAGGGTCATTGATGGAAAGGAGACTCGTCCAATGCATCTGCAG
ACGGCGGATATGCGGATGCCAGCTTATAAGGCGAAGAACTGGGACTTGATGGCCGTCTCGGGGGTGGTGATGGGG
TTGCTTGGTGGGGGCTTGTACTATGCTGGACGGCTCGCTTGGATCAATCGCCGGGCTATTGGTGGAGTTGTTGAC
GGTTTGGTTTGCAAAATTTATGATTAG
Transcript >Ani_SJS115_1|g8131.t1
ATGCATCATCCCGAGCGTGCGGCTATTTATCCCAACTCCGCCCAACACAAGGCTATGTCGGACATCATCCTGCCA
CCCAGGAAGATTCTCCTGGTAGTTACTGGAGGAGGCTACACCCATGCCGCCCCGGTTCTTGAACTGGGGAAGGTC
CTGGCCAACCGAGGGCACGTAGTCGACTTCGCAACGCTCGATGGCCAAGAGGAATGGGCCAGCGGCTTCCAGATC
TCGTCGACGCATCTCATGGGGCCTGGGCCGACAGAGGAACAGCTTGATGCGCACTACATGCGCAGCCGGCTCTGG
AATCCGGCCAGAGGTTTAGGCGATGTCATGGAGTCCAAGTACCTCTTCGACTCTCTGTGGACACAATCCTATCAT
GGACTGAAAACTATCATGGATGATCCTGCTACACGGCCGGACATGCTGCTTGCTGACTTCTTCGTCGACGCAGTC
AAGGATATCCAACTGGAATACAAGGTGCCCATTGCTATTGTCTGGCCACAGATGCCCTACTTGATGGTTCCCTGC
TCGTATATCCCCGGCCAGCCGGGCTTCCAACTCGATATGACCTTAACCTCGGAGAATGCGTCAGTATGGTCGCGC
ATCAACAATGAACTTGTAGTCGTGCGGGCCTTGCCTGAGGTGCTTAAACTGAGGAACTGGACCAGAGCCATGCGC
AAGCGAGCGGGTCTGAATTACCTTCTTCCAACGCCAAAGAAACCTAATTATCTACTTCTAGTCAACTCTTTCTTC
GGTCTCGAAGTGCCCAAAGACCTTCCTCCCTTGGTCGCAGCAGTCGGACCAATATTAGCAGATGAGTATCCTCTA
TTGGACGCGCCCTACCAGGAGTTCCTTGACCGCCACCCAAAGACCATATATATTGCCTTGGGCACGCATATCATC
CTTCCCCACGCAGATGCTCGGAAGATTCTTCAAGGACTTATCCAAGCCATGGAAGAAGGCGTTATTGACGGCGTA
ATCTGGTCAGTGGGTAGGAGCGGACGGCAGCTGTTCGACAAAGCGGAATCCTTCACTGTGCAAGGCAAGACAATT
AGCTTCGGAGACCTTCTCGAAGGGTTACACGCCGACTGGAAGTTCCCTTTCTTTGCACCACAACGGTCGATCCTG
GACCATCCCCATACCCGCATCTATTTCACCCACGGAGGTGGGTCCAGCGCCAACGAAGGCCTCTACCATGGCAAA
CCGATGCTAGTCATGTCATTCTACTTCGACCAGATCGGTAATGCGGCAAAACTGGCCGGAAGCGGAACGTCGGAG
CTGCTACACAAGTTCCGTTTCTCGGCCGATGAACTCTACTTCAAGACAAAATTGATCATGGAAGACCGTGACGGG
GGCTATGCGCGCAATGTGCAGCGTCTCCAGCGTATTGCCCATGTGGCGTCTCGACGCAAGTATTTGGGCGCTGAT
CTGATCGAGGAAGTTCTGTACGATACTGAGTCGAGGGTCATTGATGGAAAGGAGACTCGTCCAATGCATCTGCAG
ACGGCGGATATGCGGATGCCAGCTTATAAGGCGAAGAACTGGGACTTGATGGCCGTCTCGGGGGTGGTGATGGGG
TTGCTTGGTGGGGGCTTGTACTATGCTGGACGGCTCGCTTGGATCAATCGCCGGGCTATTGGTGGAGTTGTTGAC
GGTTTGGTTTGCAAAATTTATGATTAG
Gene >Ani_SJS115_1|g8131.t1
ATGCATCATCCCGAGCGTGCGGCTATTTATCCCAACTCCGCCCAACACAAGGCTATGTCGGACATCATCCTGCCA
CCCAGGAAGATTCTCCTGGTAGTTACTGGAGGAGGCTACACCCATGCCGGTGAGTATGCCTGCCTATTGTTTAGC
CTTACAGATTCTAATTGGATACAAATGGTTCATTGCAGCCCCGGTTCTTGAACTGGGGAAGGTCCTGGCCAACCG
AGGGCACGTAGTCGACTTCGCAACGCTCGATGGCCAAGAGGAATGGGCCAGCGGCTTCCAGATCTCGTCGACGCA
TCTCATGGGGCCTGGGCCGACAGAGGAACAGCTTGATGCGCACTACATGCGCAGCCGGCTCTGGAATCCGGCCAG
AGGTTTAGGCGATGTCATGGAGTCCAAGTACCTCTTCGACTCTCTGTGGACACAATCCTATCATGGACTGAAAAC
TATCATGGATGATCCTGCTACACGGCCGGACATGCTGCTTGCTGACTTCTTCGTCGACGCAGTCAAGGATATCCA
ACTGGAATACAAGGTGCCCATTGCTATTGTCTGGCCACAGATGCCCTACTTGATGGTTCCCTGCTCGTATATCCC
CGGCCAGCCGGGCTTCCAACTCGATATGACCTTAACCTCGGAGAATGCGTCAGTATGGTCGCGCATCAACAATGA
ACTTGTAGTCGTGCGGGCCTTGCCTGAGGTGCTTAAACTGAGGAACTGGACCAGAGCCATGCGCAAGCGAGCGGG
TCTGAATTACCTTCTTCCAACGCCAAAGAAACCTAATTATCTACTTCTAGTCAACTCTTTCTTCGGTCTCGAAGT
GCCCAAAGACCTTCCTCCCTTGGTCGCAGCAGTCGGACCAATATTAGCAGATGAGTATCCTCTATTGGACGCGCC
CTACCAGGAGTTCCTTGACCGCCACCCAAAGACCATATATATTGCCTTGGGCACGCATATCATCCTTCCCCACGC
AGATGCTCGGAAGATTCTTCAAGGACTTATCCAAGCCATGGAAGAAGGCGTTATTGACGGCGTAATCTGGTCAGT
GGGTAGGAGCGGACGGCAGCTGTTCGACAAAGCGGAATCCTTCACTGTGCAAGGCAAGACAATTAGCTTCGGAGA
CCTTCTCGAAGGGTTACACGCCGACTGGAAGTTCCCTTTCTTTGCACCACAACGGTCGATCCTGGACCATCCCCA
TACCCGCATCTATTTCACCCACGGAGGTGGGTCCAGCGCCAACGAAGGCCTCTACCATGGCAAACCGATGCTAGT
CATGTCATTCTACTTCGACCAGATCGGTAATGCGGCAAAACTGGCCGGAAGCGGAACGTCGGAGCTGCTACACAA
GTTCCGTTTCTCGGCCGATGAACTCTACTTCAAGACAAAATTGATCATGGAAGACCGTGACGGGGGCTATGCGCG
CAATGTGCAGCGTCTCCAGCGTATTGCCCATGTGGCGTCTCGACGCAAGTATTTGGGCGCTGATCTGATCGAGGA
AGTTCTGTACGATACTGAGTCGAGGGTCATTGATGGAAAGGAGACTCGTCCAATGCATCTGCAGACGGCGGATAT
GCGGATGCCAGCTTATAAGGCGAAGAACTGGGACTTGATGGCCGTCTCGGGGGTGGTGATGGGGTTGCTTGGTGG
GGGCTTGTACTATGCTGGACGGCTCGCTTGGATCAATCGCCGGGCTATTGGTGGAGTTGTTGACGGTTTGGTTTG
CAAAATTTATGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail