Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS115_1|g5565.t1
Gene name
Locationscaffold_032:331996..332510
Strand+
Gene length (bp)514
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.943327

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup11856
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 147343 Ani_SJS115_1|g5565.t1 (this protein)
Aspergillus niger CBS 147344 Ani_SJS70_1|g7838.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g7265.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS115_1|g5565.t1
MTGSEWSTIWTASLLVCYGQSWAAPFTERSSRRAREREREALLVWIVNPEILIAAAESIVVQFDFRPCWTVTLCS
LLQRASLSPLLYISFRCPLPPTAPLLDRSVHHLEF*
Coding >Ani_SJS115_1|g5565.t1
ATGACTGGGTCCGAGTGGAGTACCATCTGGACTGCTAGTCTTCTAGTCTGCTACGGGCAGTCATGGGCAGCCCCT
TTTACGGAGCGCTCGAGCAGACGAGCGAGAGAGCGAGAGAGAGAGGCGCTCCTCGTGTGGATCGTGAACCCTGAA
ATTCTTATTGCTGCTGCTGAATCAATCGTTGTCCAATTTGACTTTCGACCCTGTTGGACCGTCACTCTCTGTTCT
CTGCTTCAACGTGCGTCGCTATCGCCCCTTCTTTACATAAGTTTTCGCTGTCCTCTTCCTCCCACGGCCCCCCTA
CTCGACCGATCGGTCCACCATCTAGAATTCTGA
Transcript >Ani_SJS115_1|g5565.t1
ATGACTGGGTCCGAGTGGAGTACCATCTGGACTGCTAGTCTTCTAGTCTGCTACGGGCAGTCATGGGCAGCCCCT
TTTACGGAGCGCTCGAGCAGACGAGCGAGAGAGCGAGAGAGAGAGGCGCTCCTCGTGTGGATCGTGAACCCTGAA
ATTCTTATTGCTGCTGCTGAATCAATCGTTGTCCAATTTGACTTTCGACCCTGTTGGACCGTCACTCTCTGTTCT
CTGCTTCAACGTGCGTCGCTATCGCCCCTTCTTTACATAAGTTTTCGCTGTCCTCTTCCTCCCACGGCCCCCCTA
CTCGACCGATCGGTCCACCATCTAGAATTCTGA
Gene >Ani_SJS115_1|g5565.t1
ATGACTGGGTCCGAGTGGAGTACCATCTGGACTGCTAGTCTTCTAGTCTGCTACGGGCAGGTGGTTGTGTGTGCC
TGAGGATAACGCTGCAAATGCTGAAACCACCGAATCCTTGGCGCGGGGCGCTTAGTCATGGGCAGCCCCTTTTAC
GGAGCGCTCGAGCAGACGAGCGAGAGAGCGAGAGAGAGAGGCGCTCCTCGTGTGGATCGTGAACCCTGAAATTCT
TATTGCTGCTGCTGAATCAATCGTTGTCCAATTTGACTTTCGACCCTGTTGGACCGTCACTCTCTGTTCTCTGCT
TCAACGTGCGTCGCTATCGCCCCTTCTTTACATAAGGTGAGTTCCATATGTCTTGTTTACCTTGCGTCTGCGAAC
GCATGGTCCATTATGGAGACGTCGCCCTGTTGACGCGGACCGCTAGCACGGGGTAATTGACCTTACGTTTAGTTT
TCGCTGTCCTCTTCCTCCCACGGCCCCCCTACTCGACCGATCGGTCCACCATCTAGAATTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail