Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9967.t1
Gene name
Locationscaffold_101:51540..53389
Strand-
Gene length (bp)1849
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-39 33 409
PF07690 MFS_1 Major Facilitator Superfamily 6.3E-15 291 476

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 70 92 22
3 99 121 22
4 126 148 22
5 160 182 22
6 187 209 22
7 282 304 22
8 319 341 22
9 348 370 22
10 380 402 22
11 429 451 22
12 455 477 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9967.t1
MHRDEPLPDPPSTSSPPWKLAFRSSRAFVISVVAIAVFTDVFIYGMIVPILPIVLKTRVIVPEDELQKWMSIMLA
AFGGGIFFGSPIFGYFADRSSSRQLPFLIGLLALAGTTIVFWFAETVSSLVIARSLQGLSAAVVWTVGLALVVDT
VGKDQVGAAMGYVSMALTVGTVFGPFIGGIMLSRVGYHAVFVLAIGLIVLDICLRLVMVEPKNAAQWIQSGSGGE
TQALLNEAETHGAGYDAITANARAGQTSGLGNEYPTEGSGEPLTSGRSTSVPGIIRLIFSGKLLVVLLATVVDAI
IWSAFDTVLPLYVMKTFGWGSFEIGLCFLPLFAPSFLSPWIGDAVDRWGALRVAFVGFLLDFPTLLLFQLVARNT
TQDQVLLYVFLFLAGVASTLQMVSLMTEVNNVTERYEREFPGIFGHQGGTAQAYGLFNVAWSGGQVLGPLVAGLL
VERAGWTTMVTVLGAVSGGISVVIALSDRRVLPVRGKK*
Coding >Ani_SJS100_1|g9967.t1
ATGCATCGAGATGAACCTCTTCCCGATCCGCCTTCCACTAGTTCTCCGCCATGGAAGCTCGCTTTTCGCTCCTCC
AGGGCGTTTGTGATCTCAGTGGTGGCTATTGCGGTCTTCACGGATGTGTTCATTTATGGCATGATCGTCCCTATC
TTGCCTATTGTGCTCAAAACACGCGTGATTGTACCGGAAGATGAATTGCAAAAATGGATGTCAATCATGCTGGCC
GCGTTCGGCGGTGGTATATTCTTCGGATCCCCAATATTCGGTTATTTCGCGGACAGAAGCTCATCACGCCAGCTT
CCGTTTCTTATTGGACTGCTCGCGCTCGCTGGGACGACTATCGTGTTCTGGTTCGCAGAAACAGTATCGTCCTTG
GTCATTGCACGCAGTCTCCAAGGATTGTCAGCTGCTGTGGTCTGGACTGTTGGTTTGGCTCTTGTTGTCGACACG
GTGGGCAAGGATCAGGTGGGAGCTGCAATGGGATATGTCTCGATGGCACTGACTGTGGGGACGGTGTTTGGTCCA
TTCATTGGAGGGATCATGCTGTCGCGAGTGGGCTATCATGCGGTATTTGTATTGGCAATTGGGTTGATAGTGCTA
GATATCTGTCTTCGGCTCGTGATGGTCGAACCCAAGAATGCTGCGCAATGGATTCAGTCGGGCAGTGGCGGAGAG
ACACAAGCTCTGCTAAATGAAGCCGAAACGCATGGCGCTGGGTACGATGCGATTACCGCCAATGCTAGAGCAGGA
CAGACATCTGGCCTCGGTAACGAATATCCAACCGAGGGCAGCGGCGAGCCGCTGACCAGCGGGAGGTCGACCTCC
GTACCTGGGATTATCCGCTTGATATTCTCAGGCAAGTTACTGGTCGTTCTTCTAGCGACGGTAGTGGATGCCATT
ATCTGGTCCGCTTTTGATACGGTGCTCCCGCTGTATGTCATGAAAACGTTCGGCTGGGGATCATTCGAAATCGGG
CTATGTTTCCTACCTCTCTTTGCACCGTCTTTCCTCTCTCCATGGATTGGTGACGCAGTAGACCGTTGGGGAGCA
CTTCGGGTAGCCTTTGTTGGCTTCCTGCTCGATTTCCCAACATTACTGCTTTTTCAGCTTGTCGCACGCAACACG
ACCCAGGACCAAGTTCTTCTCTATGTGTTCCTCTTCCTCGCAGGTGTCGCTTCGACCCTGCAGATGGTCTCGTTG
ATGACGGAGGTCAACAACGTCACGGAGCGGTACGAGCGGGAATTCCCCGGTATCTTCGGACATCAAGGAGGGACT
GCGCAAGCGTACGGGCTTTTCAATGTCGCCTGGTCGGGCGGGCAGGTACTGGGACCCTTGGTCGCGGGTCTGCTA
GTTGAGCGAGCCGGCTGGACGACAATGGTGACGGTGTTGGGGGCAGTTAGCGGAGGCATTTCCGTGGTTATCGCG
CTCTCGGATCGAAGGGTTCTGCCAGTGAGGGGAAAGAAGTGA
Transcript >Ani_SJS100_1|g9967.t1
ATGCATCGAGATGAACCTCTTCCCGATCCGCCTTCCACTAGTTCTCCGCCATGGAAGCTCGCTTTTCGCTCCTCC
AGGGCGTTTGTGATCTCAGTGGTGGCTATTGCGGTCTTCACGGATGTGTTCATTTATGGCATGATCGTCCCTATC
TTGCCTATTGTGCTCAAAACACGCGTGATTGTACCGGAAGATGAATTGCAAAAATGGATGTCAATCATGCTGGCC
GCGTTCGGCGGTGGTATATTCTTCGGATCCCCAATATTCGGTTATTTCGCGGACAGAAGCTCATCACGCCAGCTT
CCGTTTCTTATTGGACTGCTCGCGCTCGCTGGGACGACTATCGTGTTCTGGTTCGCAGAAACAGTATCGTCCTTG
GTCATTGCACGCAGTCTCCAAGGATTGTCAGCTGCTGTGGTCTGGACTGTTGGTTTGGCTCTTGTTGTCGACACG
GTGGGCAAGGATCAGGTGGGAGCTGCAATGGGATATGTCTCGATGGCACTGACTGTGGGGACGGTGTTTGGTCCA
TTCATTGGAGGGATCATGCTGTCGCGAGTGGGCTATCATGCGGTATTTGTATTGGCAATTGGGTTGATAGTGCTA
GATATCTGTCTTCGGCTCGTGATGGTCGAACCCAAGAATGCTGCGCAATGGATTCAGTCGGGCAGTGGCGGAGAG
ACACAAGCTCTGCTAAATGAAGCCGAAACGCATGGCGCTGGGTACGATGCGATTACCGCCAATGCTAGAGCAGGA
CAGACATCTGGCCTCGGTAACGAATATCCAACCGAGGGCAGCGGCGAGCCGCTGACCAGCGGGAGGTCGACCTCC
GTACCTGGGATTATCCGCTTGATATTCTCAGGCAAGTTACTGGTCGTTCTTCTAGCGACGGTAGTGGATGCCATT
ATCTGGTCCGCTTTTGATACGGTGCTCCCGCTGTATGTCATGAAAACGTTCGGCTGGGGATCATTCGAAATCGGG
CTATGTTTCCTACCTCTCTTTGCACCGTCTTTCCTCTCTCCATGGATTGGTGACGCAGTAGACCGTTGGGGAGCA
CTTCGGGTAGCCTTTGTTGGCTTCCTGCTCGATTTCCCAACATTACTGCTTTTTCAGCTTGTCGCACGCAACACG
ACCCAGGACCAAGTTCTTCTCTATGTGTTCCTCTTCCTCGCAGGTGTCGCTTCGACCCTGCAGATGGTCTCGTTG
ATGACGGAGGTCAACAACGTCACGGAGCGGTACGAGCGGGAATTCCCCGGTATCTTCGGACATCAAGGAGGGACT
GCGCAAGCGTACGGGCTTTTCAATGTCGCCTGGTCGGGCGGGCAGGTACTGGGACCCTTGGTCGCGGGTCTGCTA
GTTGAGCGAGCCGGCTGGACGACAATGGTGACGGTGTTGGGGGCAGTTAGCGGAGGCATTTCCGTGGTTATCGCG
CTCTCGGATCGAAGGGTTCTGCCAGTGAGGGGAAAGAAGTGA
Gene >Ani_SJS100_1|g9967.t1
ATGCATCGAGATGAACCTCTTCCCGATCCGCCTTCCACTAGTTCTCCGCCATGGAAGCTCGCTTTTCGCTCCTCC
AGGGCGTTTGTGATCTCAGTGGTGGCTATTGCGGTCTTCACGGTATTTGACCTTCACAATGATGAATGAAGCTTT
GTGCTGATATTGTGGCAACAGGATGTGTTCATTTATGGCATGGTAACTGCGCCAACTTTGGATCGGCTCGGAGCT
TCATCTGACCAATGTAGATCGTCCCTATCTTGCCTATTGTGCTCAAAACACGCGTGATTGTACCGGAAGATGAAT
GTAGGATGTCTCTGTATGACATTTGACAAGACAACAGGCTAATCGTCACAGTGCAAAAATGGATGTCAATCATGC
TGGCCGCGTTCGGCGGTGGTATATTCTTCGGATCCCGTAGGTGCCGTTTCCTTCCTTCGTGGTATGGGTGCGGCT
AACACCAGATTGCTAGCAATATTCGGTTATTTCGCGGACAGAAGCTCATCACGCCAGCTTCCGTTTCTTATTGGA
CTGCTCGCGCTCGCTGGGACGACTATCGTGTTCTGGTTCGCAGAAACAGTATCGTCCTTGGTCATTGCACGCAGT
CTCCAAGGATTGTCAGCTGCTGTGGTCTGGACTGTTGGTTTGGCTCTTGTTGTCGACACGGTGGGCAAGGATCAG
GTGGGAGCTGCAATGGGATATGTCTCGATGGCACTGACTGTGGGGACGGTGTTTGGTCCATTCATTGGAGGGATC
ATGTGAGTTCAGTATATTGTCGCATTGGAAGCTTGATCGGCGATTTACTGATTATCTAGGCTGTCGCGAGTGGGC
TATCATGCGGTATTTGTATTGGCAATTGGGTTGATAGTGCTAGATATCTGTCTTCGGCTCGTGATGGTCGAACCC
AAGAATGCTGCGCAATGGATTCAGTCGGGCAGTGGCGGAGAGACACAAGCTCTGCTAAATGAAGCCGAAACGCAT
GGCGCTGGGTACGATGCGATTACCGCCAATGCTAGAGCAGGACAGACATCTGGCCTCGGTAACGAATATCCAACC
GAGGGCAGCGGCGAGCCGCTGACCAGCGGGAGGTCGACCTCCGTACCTGGGATTATCCGCTTGATATTCTCAGGC
AAGTTACTGGTCGTTCTTCTAGCGACGGTAGTGGATGCCATTATCTGGTCCGCTTTTGATACGGTATGTGGCCCG
TGGAAGAGCGCTTAGTCCTTTGTGGTCGAATATCAAGTTAACGAGGTCAGGTGCTCCCGCTGTATGTCATGAAAA
CGTTCGGCTGGGGATCATTCGAAATCGGGCTATGTTTCCTACCTCTCTTTGCACCGTCTTTCCTCTCTCCATGGA
TTGGTATGCATCAGGCGGTTCCTATGCCTTCTATCTCTGCTGATCAATGACTGTAGGTGACGCAGTAGACCGTTG
GGGAGCACTTCGGGTAGCCTTTGTTGGCTTCCTGCTCGATTTCCCAACATTACTGCTTTTTCAGCTTGTCGCACG
CAACACGACCCAGGACCAAGTTCTTCTCTATGTGTTCCTCTTCCTCGCAGGTGTCGCTTCGACCCTGCAGATGGT
CTCGTTGATGACGGAGGTCAACAACGTCACGGAGCGGTACGAGCGGGAATTCCCCGGTATCTTCGGACATCAAGG
AGGGACTGCGCAAGCGTACGGGCTTTTCAATGTCGCCTGGTCGGGCGGGCAGGTACTGGGACCCTTGGTCGCGGG
TCTGCTAGTTGAGCGAGCCGGCTGGACGACAATGGTGACGGTGTTGGGGGCAGTTAGCGGAGGCATTTCCGTGGT
TATCGCGCTCTCGGATCGAAGGGTTCTGCCAGTGAGGGGAAAGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail