Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9919.t1
Gene name
Locationscaffold_099:92205..92987
Strand-
Gene length (bp)782
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase 2.0E-56 19 198

GO

GO Term Description Terminal node
GO:0009349 riboflavin synthase complex Yes
GO:0009231 riboflavin biosynthetic process Yes
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006766 vitamin metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:1902494 catalytic complex No
GO:0032991 protein-containing complex No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1990234 transferase complex No
GO:0042727 flavin-containing compound biosynthetic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0009110 vitamin biosynthetic process No
GO:0042726 flavin-containing compound metabolic process No
GO:0005575 cellular_component No
GO:0018130 heterocycle biosynthetic process No
GO:0006771 riboflavin metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup9980
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g2878.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g8451.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g6930.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g5706.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g6270.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g9016.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g9921.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g10433.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g9399.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g9008.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g9299.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g10480.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g3851.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g7637.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g7223.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g4261.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g8388.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g10294.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g10297.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g9919.t1 (this protein)
Aspergillus niger CBS 147371 Ani_SJS27_1|g6638.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g8824.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g10376.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g10841.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9919.t1
MTSVSLKGPGAAQTYDGAGLRIAIVHARWNMGIIGPLVDGAKRSLLAAGVSENNITVHTVPGSYELPFAVQKLYA
ASQIEASKGSASAQGISATDLLSSSTADLTKASPQSPSSDTPRPFDAIIAVGVLIKGETMHFEYIADAVSHGLMR
VQLDTGVPVIFGVLTVLTEEQGLERAGMGKKGMHNHGEDWGNAAVELGAKRRDWAEGKVV*
Coding >Ani_SJS100_1|g9919.t1
ATGACTTCTGTGTCTCTGAAAGGCCCAGGCGCTGCGCAGACATACGATGGGGCTGGGCTACGAATCGCCATTGTC
CATGCGAGGTGGAATATGGGCATAATTGGTCCTCTCGTGGATGGGGCTAAGCGGAGCCTCCTTGCAGCTGGAGTT
TCTGAGAATAACATAACCGTCCACACTGTTCCAGGCAGTTATGAGTTGCCCTTCGCCGTGCAGAAGTTATACGCG
GCTTCCCAGATTGAAGCTTCCAAAGGCTCAGCCTCGGCGCAAGGCATCAGTGCCACCGATTTGCTGTCCTCCTCT
ACAGCGGACCTCACGAAGGCATCTCCACAGTCGCCATCTTCCGATACGCCTAGACCTTTTGATGCCATCATTGCC
GTTGGAGTGCTGATTAAAGGGGAGACTATGCATTTCGAATACATCGCGGATGCCGTCTCTCATGGATTGATGCGT
GTGCAGCTCGATACGGGAGTGCCGGTCATCTTTGGCGTGCTTACTGTCTTGACTGAAGAGCAAGGCTTGGAAAGA
GCCGGCATGGGCAAAAAAGGGATGCACAACCATGGAGAGGACTGGGGTAATGCTGCAGTAGAACTTGGAGCAAAG
AGAAGAGACTGGGCTGAGGGTAAAGTTGTTTAG
Transcript >Ani_SJS100_1|g9919.t1
ATGACTTCTGTGTCTCTGAAAGGCCCAGGCGCTGCGCAGACATACGATGGGGCTGGGCTACGAATCGCCATTGTC
CATGCGAGGTGGAATATGGGCATAATTGGTCCTCTCGTGGATGGGGCTAAGCGGAGCCTCCTTGCAGCTGGAGTT
TCTGAGAATAACATAACCGTCCACACTGTTCCAGGCAGTTATGAGTTGCCCTTCGCCGTGCAGAAGTTATACGCG
GCTTCCCAGATTGAAGCTTCCAAAGGCTCAGCCTCGGCGCAAGGCATCAGTGCCACCGATTTGCTGTCCTCCTCT
ACAGCGGACCTCACGAAGGCATCTCCACAGTCGCCATCTTCCGATACGCCTAGACCTTTTGATGCCATCATTGCC
GTTGGAGTGCTGATTAAAGGGGAGACTATGCATTTCGAATACATCGCGGATGCCGTCTCTCATGGATTGATGCGT
GTGCAGCTCGATACGGGAGTGCCGGTCATCTTTGGCGTGCTTACTGTCTTGACTGAAGAGCAAGGCTTGGAAAGA
GCCGGCATGGGCAAAAAAGGGATGCACAACCATGGAGAGGACTGGGGTAATGCTGCAGTAGAACTTGGAGCAAAG
AGAAGAGACTGGGCTGAGGGTAAAGTTGTTTAG
Gene >Ani_SJS100_1|g9919.t1
ATGACTTCTGTGTCTCTGAAAGGCCCAGGCGCTGCGCAGACATACGATGGTAATAACCTCTTTCAGGATGATCGT
ATGATTAATGATCCGTCTGCTAAATGATGGAATCTTAGGGGCTGGGCTACGAATCGCCATTGTCCATGCGAGGTG
GAATATGGGCATAATTGGTCCTCTCGTGGATGGGGCTAAGCGGAGCCTCCTTGCAGCTGGAGTTTCTGAGAATAA
CATAACCGTCCACACTGTTCCAGGCAGTTATGAGTTGCCCTTCGCCGTGCAGAAGTAAGCATATTGTCATCATGT
CTTTTCCTTCTCGGGCATTTCATTGGAGACTTCGGAGACTGATGCTGACTTTGTACGCTGTCAGGTTATACGCGG
CTTCCCAGATTGAAGCTTCCAAAGGCTCAGCCTCGGCGCAAGGCATCAGTGCCACCGATTTGCTGTCCTCCTCTA
CAGCGGACCTCACGAAGGCATCTCCACAGTCGCCATCTTCCGATACGCCTAGACCTTTTGATGCCATCATTGCCG
TTGGAGTGCTGATTAAAGGGGAGACTATGCATTTCGAATACATCGCGGATGCCGTCTCTCATGGATTGATGCGTG
TGCAGCTCGATACGGGAGTGCCGGTCATCTTTGGCGTGCTTACTGTCTTGACTGAAGAGCAAGGCTTGGAAAGAG
CCGGCATGGGCAAAAAAGGGATGCACAACCATGGAGAGGACTGGGGTAATGCTGCAGTAGAACTTGGAGCAAAGA
GAAGAGACTGGGCTGAGGGTAAAGTTGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail