Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9866.t1
Gene name
Locationscaffold_098:79158..82473
Strand+
Gene length (bp)3315
Transcript length (bp)2220
Coding sequence length (bp)2220
Protein length (aa) 740

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00544 Pectate_lyase_4 Pectate lyase 5.5E-15 123 295
PF01048 PNP_UDP_1 Phosphorylase superfamily 9.6E-08 378 667

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009116 nucleoside metabolic process Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9866.t1
MKYAAALTAIAALAARAAAVGVSGTPVGFASSATGGGDATPVYPTTTDELVSYLGDDEARVIVLSKTFDFTDTEG
TTTTTGCAPWGTASGCQLAINKDDWCTNYEPDAPTTTVTYNTAGELGITVNSNKSLIGEGTSGVIKGRGLRMVSG
VSNIIIQNIAVTDINPEYVWGGDAITLDEADLVWIDHVTTARIGRQHYVLGTDADSRVSITNNYINGESDYSATC
DGHHYWNVYLDGSSDKVTFSGNYLYKTSGRAPKVQDNTYLHIYNNYWENNSGHAFEIGSGGYVLAEGNYFSNVDT
VLETDTFEGALFSSDSASSTCESYIGRSCVANVNGGDLTGTSTTVLSNLSGDTLPSADAASTSPASNAGQGNLQF
YNIAFICPTGIELAAVEGMLDELHPALPSTIDKNSYTYGRMGVHYVVVAVLPETGNDRAASVATQLNNDFRSLRF
GLLIGTGGGIPDLAKGRDIRLGDVVVSKPTELFGGVVQLDRGKSHAHGRFERTGIQQKPPDILLSTAQRLDALHA
RLDTHIPFFMEEMLERYPKMKNRNYVHQGDEKDQLFRTEYEHAGGSDCGHCHPIQAIERVPREDSTPAIHYGTIG
SSKTLLRDSVRREILKADFDILCVETEAATLMNEIPCLVVCGISDYADSHSNTTWQPYAAATAAAYAKELLSLIP
PLSKPSKDNIEVAPFASKQQAPTIPTPRIKYLIHDPVAGDLVAGRNLFSSGIYPDGKMERCIYG*
Coding >Ani_SJS100_1|g9866.t1
ATGAAGTACGCTGCTGCTCTCACGGCTATTGCCGCCCTCGCTGCCCGCGCCGCTGCTGTCGGTGTCTCCGGCACT
CCCGTGGGTTTCGCCTCCTCCGCCACTGGTGGTGGTGATGCTACCCCCGTCTACCCTACCACCACCGATGAGCTG
GTCTCTTACCTCGGTGATGACGAGGCCCGTGTCATTGTCCTGTCCAAGACTTTCGACTTCACTGACACTGAGGGC
ACTACCACGACCACCGGTTGCGCTCCCTGGGGTACTGCCTCCGGCTGCCAGCTGGCCATCAACAAGGACGACTGG
TGCACCAACTACGAGCCCGATGCTCCCACCACCACCGTCACCTACAACACTGCTGGTGAACTCGGTATCACCGTC
AACTCCAACAAGTCCTTGATCGGTGAGGGTACCAGCGGTGTCATCAAGGGCCGTGGTCTCCGCATGGTCAGCGGT
GTCTCCAACATCATCATCCAGAACATTGCTGTCACCGACATCAACCCCGAGTACGTCTGGGGTGGTGACGCCATC
ACCCTCGACGAGGCTGACTTGGTCTGGATTGACCACGTTACTACTGCCCGCATTGGTCGCCAGCACTACGTCCTC
GGTACCGACGCCGACAGCCGTGTCTCCATCACCAACAACTACATCAACGGCGAGTCTGACTACTCTGCTACTTGC
GACGGCCACCACTACTGGAACGTGTACCTTGACGGCTCTAGCGACAAGGTCACCTTCAGTGGCAACTACCTGTAC
AAGACCTCCGGCCGTGCCCCCAAGGTCCAGGACAACACCTACCTCCACATCTACAACAACTACTGGGAGAACAAC
TCGGGCCACGCTTTCGAGATCGGCTCCGGTGGCTACGTCCTCGCCGAGGGTAACTACTTCTCCAACGTCGACACC
GTCCTCGAGACCGACACCTTCGAGGGTGCTCTCTTCTCCTCTGACAGCGCCTCCTCCACCTGCGAGTCCTACATT
GGCCGTTCCTGCGTTGCCAACGTCAACGGCGGTGACCTCACCGGCACCTCCACCACCGTCCTCTCCAACCTCAGC
GGCGACACCCTCCCCTCTGCTGATGCTGCCAGCACCAGCCCCGCCTCCAACGCTGGTCAGGGTAACCTGCAATTT
TATAACATCGCGTTCATCTGCCCAACGGGCATCGAGCTCGCCGCCGTCGAGGGAATGCTGGATGAACTGCACCCA
GCCCTCCCTTCCACCATTGACAAGAACAGCTATACTTATGGCCGCATGGGAGTACACTATGTAGTAGTGGCAGTA
TTGCCCGAAACAGGCAACGACCGGGCCGCATCTGTCGCGACACAACTTAACAACGACTTCAGATCTCTCCGATTC
GGTTTACTGATCGGGACTGGTGGGGGCATACCAGACCTTGCAAAAGGTCGAGATATTCGGCTTGGGGATGTGGTG
GTCAGCAAGCCGACTGAATTATTTGGAGGCGTAGTACAACTTGATCGCGGGAAATCTCATGCTCATGGTCGATTC
GAGCGAACGGGGATACAGCAGAAGCCACCGGATATTCTCCTGTCTACGGCGCAAAGGTTAGACGCTCTTCATGCG
CGCCTTGATACTCATATTCCCTTCTTTATGGAGGAAATGCTCGAGAGATATCCAAAGATGAAGAACCGGAATTAT
GTTCATCAGGGAGACGAAAAAGACCAACTGTTCCGGACGGAGTATGAGCACGCAGGTGGATCAGACTGTGGGCAC
TGCCACCCGATCCAGGCCATTGAACGTGTGCCACGAGAGGATTCGACGCCAGCCATTCACTATGGAACTATCGGG
TCTTCCAAGACCCTTCTCAGAGACAGTGTGAGAAGGGAGATTCTGAAAGCCGACTTCGATATTCTGTGTGTTGAG
ACGGAAGCAGCGACGTTGATGAACGAGATCCCTTGTCTGGTAGTCTGTGGCATCAGTGACTATGCAGATTCACAT
AGTAACACGACATGGCAGCCATACGCTGCTGCTACGGCTGCTGCATATGCCAAGGAGTTGCTTTCGCTGATTCCT
CCTCTGAGCAAGCCTTCAAAAGACAACATCGAAGTGGCTCCGTTTGCATCGAAACAGCAAGCTCCCACTATTCCA
ACACCTAGAATTAAATACTTGATTCATGATCCGGTCGCTGGTGATTTAGTAGCTGGAAGGAACTTGTTCAGCAGT
GGAATCTATCCTGATGGCAAGATGGAAAGGTGCATATATGGTTAG
Transcript >Ani_SJS100_1|g9866.t1
ATGAAGTACGCTGCTGCTCTCACGGCTATTGCCGCCCTCGCTGCCCGCGCCGCTGCTGTCGGTGTCTCCGGCACT
CCCGTGGGTTTCGCCTCCTCCGCCACTGGTGGTGGTGATGCTACCCCCGTCTACCCTACCACCACCGATGAGCTG
GTCTCTTACCTCGGTGATGACGAGGCCCGTGTCATTGTCCTGTCCAAGACTTTCGACTTCACTGACACTGAGGGC
ACTACCACGACCACCGGTTGCGCTCCCTGGGGTACTGCCTCCGGCTGCCAGCTGGCCATCAACAAGGACGACTGG
TGCACCAACTACGAGCCCGATGCTCCCACCACCACCGTCACCTACAACACTGCTGGTGAACTCGGTATCACCGTC
AACTCCAACAAGTCCTTGATCGGTGAGGGTACCAGCGGTGTCATCAAGGGCCGTGGTCTCCGCATGGTCAGCGGT
GTCTCCAACATCATCATCCAGAACATTGCTGTCACCGACATCAACCCCGAGTACGTCTGGGGTGGTGACGCCATC
ACCCTCGACGAGGCTGACTTGGTCTGGATTGACCACGTTACTACTGCCCGCATTGGTCGCCAGCACTACGTCCTC
GGTACCGACGCCGACAGCCGTGTCTCCATCACCAACAACTACATCAACGGCGAGTCTGACTACTCTGCTACTTGC
GACGGCCACCACTACTGGAACGTGTACCTTGACGGCTCTAGCGACAAGGTCACCTTCAGTGGCAACTACCTGTAC
AAGACCTCCGGCCGTGCCCCCAAGGTCCAGGACAACACCTACCTCCACATCTACAACAACTACTGGGAGAACAAC
TCGGGCCACGCTTTCGAGATCGGCTCCGGTGGCTACGTCCTCGCCGAGGGTAACTACTTCTCCAACGTCGACACC
GTCCTCGAGACCGACACCTTCGAGGGTGCTCTCTTCTCCTCTGACAGCGCCTCCTCCACCTGCGAGTCCTACATT
GGCCGTTCCTGCGTTGCCAACGTCAACGGCGGTGACCTCACCGGCACCTCCACCACCGTCCTCTCCAACCTCAGC
GGCGACACCCTCCCCTCTGCTGATGCTGCCAGCACCAGCCCCGCCTCCAACGCTGGTCAGGGTAACCTGCAATTT
TATAACATCGCGTTCATCTGCCCAACGGGCATCGAGCTCGCCGCCGTCGAGGGAATGCTGGATGAACTGCACCCA
GCCCTCCCTTCCACCATTGACAAGAACAGCTATACTTATGGCCGCATGGGAGTACACTATGTAGTAGTGGCAGTA
TTGCCCGAAACAGGCAACGACCGGGCCGCATCTGTCGCGACACAACTTAACAACGACTTCAGATCTCTCCGATTC
GGTTTACTGATCGGGACTGGTGGGGGCATACCAGACCTTGCAAAAGGTCGAGATATTCGGCTTGGGGATGTGGTG
GTCAGCAAGCCGACTGAATTATTTGGAGGCGTAGTACAACTTGATCGCGGGAAATCTCATGCTCATGGTCGATTC
GAGCGAACGGGGATACAGCAGAAGCCACCGGATATTCTCCTGTCTACGGCGCAAAGGTTAGACGCTCTTCATGCG
CGCCTTGATACTCATATTCCCTTCTTTATGGAGGAAATGCTCGAGAGATATCCAAAGATGAAGAACCGGAATTAT
GTTCATCAGGGAGACGAAAAAGACCAACTGTTCCGGACGGAGTATGAGCACGCAGGTGGATCAGACTGTGGGCAC
TGCCACCCGATCCAGGCCATTGAACGTGTGCCACGAGAGGATTCGACGCCAGCCATTCACTATGGAACTATCGGG
TCTTCCAAGACCCTTCTCAGAGACAGTGTGAGAAGGGAGATTCTGAAAGCCGACTTCGATATTCTGTGTGTTGAG
ACGGAAGCAGCGACGTTGATGAACGAGATCCCTTGTCTGGTAGTCTGTGGCATCAGTGACTATGCAGATTCACAT
AGTAACACGACATGGCAGCCATACGCTGCTGCTACGGCTGCTGCATATGCCAAGGAGTTGCTTTCGCTGATTCCT
CCTCTGAGCAAGCCTTCAAAAGACAACATCGAAGTGGCTCCGTTTGCATCGAAACAGCAAGCTCCCACTATTCCA
ACACCTAGAATTAAATACTTGATTCATGATCCGGTCGCTGGTGATTTAGTAGCTGGAAGGAACTTGTTCAGCAGT
GGAATCTATCCTGATGGCAAGATGGAAAGGTGCATATATGGTTAG
Gene >Ani_SJS100_1|g9866.t1
ATGAAGTACGCTGCTGCTCTCACGGCTATTGCCGCCCTCGCTGCCCGCGCCGCTGCTGTCGGTGTCTCCGGCACT
CCCGTGGGTTTCGCCTCCTCCGCCACTGGTGGTGGTGATGCTACCCCCGTCTACCCTACCACCACCGATGAGCTG
GTCTCTTACCTCGGTGATGACGAGGCCCGTGTCATTGTCCTGTCCAAGACGTGAGTTTTGAATCCAAAGCAATGA
ACGAATCGATTCCCGGCTGACCAGTGTCCGAATTTGCCAGTTTCGACTTCACTGACACTGAGGGCACTACCACGA
CCACCGGTTGCGCTCCCTGGGGTACTGCCTCCGGCTGCCAGCTGGCCATCAACAAGGACGACTGGTGCACCAACT
ACGAGCCCGATGCTCCCACCACCACCGTCACCTAGTAAGTTGCCTTCTGAGGTATCCTCGAGTATCAAGGAAGAG
GAAATGCTGACAAGAGGATAGCAACACTGCTGGTGAACTCGGTATCACCGTCAACTCCAACAAGTCCTTGATCGG
TGAGGGTACCAGCGGTGTCATCAAGGGCCGTGGTCTCCGCATGGTCAGCGGTGTCTCCAACATCATCATCCAGTA
TGCATCGTCCAGGACTACATACATTACTCCCATCGCAAACTAACCATGGAATTCCCACAGGAACATTGCTGTCAC
CGACATCAACCCCGAGTACGTCTGGGGTGGTGACGCCATCACCCTCGACGAGGCTGACTTGGTCTGGATTGACCA
CGTTACTGTAAGTCGCCATCCAGCATCATGATTTTCATCCTTCCACCACTAATGAATGCTTCAGACTGCCCGCAT
TGGTCGCCAGCACTACGTCCTCGGTACCGACGCCGACAGCCGTGTCTCCATCACCAACAACTACATCAACGGCGA
GTCTGACTACTCTGCTACTTGCGACGGCCACCACTACTGGAACGTGTACCTTGACGGCTCTAGCGACAAGGTCAC
CTTCAGTGGCAACTACCTGTACAAGACCTCCGGCCGTGCCCCCAAGGTCCAGGACAACACCTACCTCCACATCTA
CAACAACTACTGGGAGAACAACTCGGGCCACGCTTTCGAGATCGGCTCCGGTGGCTACGTCCTCGCCGAGGGTAA
CTACTTCTCCAACGTCGACACCGTCCTCGAGACCGACACCTTCGAGGGTGCTCTCTTCTCCTCTGACAGCGCCTC
CTCCACCTGCGAGTCCTACATTGGCCGTTCCTGCGTTGCCAACGTCAACGGCGGTGACCTCACCGGCACCTCCAC
CACCGTCCTCTCCAACCTCAGCGGCGACACCCTCCCCTCTGCTGATGCTGCCAGCACCAGCCCCGCCTCCAACGC
TGGTCAGGGTAACCTGTAAGCGGTATCGCTCCGTCGGGCTCTTACTGCAGATCGCTTTGGTGATGTTGTCGAGTT
TGATGATTCAGACAAGACGAGTTGAGTTTTCTGCTGTTGTACAGCGGAAAAGTGTGTTCGCTTAGATTCTATCTT
AGCCTAATCAATAATTCTAAGATGGACTTGATCCATAGTAATTCTCCATTCAATTGTGATTTAGTAAATTTGATT
TTCTTTGCCTAGTCGCGCTTCTAAACTAGGATCACAGCTGCTCTTAGATCCTCGATGCCCAAGGCCACTAACGCT
TTCTGCCTCAGGACTCCACAGTCCGAGACGGATGTACTGCCTGAGGCCTAAGTGTGCTTCTGCCCAAGGCAACAA
TGGGCATGATCATACATTCACTATACTTGTGCTCTAAGGAATAGTAGGATCGGATGTGAACCATTATATTTAACT
GAGTGATCTGTGGTCTTTTCATATTTGCAATGACTTGCTTAACTTATTTGGCCGTTCTTCCATAGATGCGATCAT
GTTCGGTAGACTTCAAAAACATGTGATTGCTGACATATTCTGCCTATTTCTGCTGCAAGGCGTATGAAAAATGGC
ATTCCTGCCGTGGCTAATGGCCAAATGCTATGGCATCACAATACTTTTTCTGCTGGCTATCACATTGCATCGAGC
TAGCGTGGATGTTTGGCGCTATAGCAAGGCCAGGCCACACAGCCTCGTGAGGGGTAAATAGGTGATGAGCTTCAA
GGGCGCTAAAACGCCGAAATAGTCAATCCAGATTCGAAACACCATATGCCTTTCTGAATAGGCAATTGTATGCCG
CGTCTCTACATCATGAGTCCACTACCCAATCTTACTCATGACAGTTATAACATCGCGTTCATCTGCCCAACGGGC
ATCGAGCTCGCCGCCGTCGAGGGAATGCTGGATGAACTGCACCCAGCCCTCCCTTCCACCATTGACAAGAACAGC
TATACTTATGGCCGCATGGGAGTACACTATGTAGTAGTGGCAGTATTGCCCGAAACAGGCAACGACCGGGCCGCA
TCTGTCGCGACACAACTTAACAACGACTTCAGATCTCTCCGATTCGGTTTACTGATCGGGACTGGTGGGGGCATA
CCAGACCTTGCAAAAGGTCGAGATATTCGGCTTGGGGATGTGGTGGTCAGCAAGCCGACTGAATTATTTGGAGGC
GTAGTACAACTTGATCGCGGGAAATCTCATGCTCATGGTCGATTCGAGCGAACGGGGATACAGCAGAAGCCACCG
GATATTCTCCTGTCTACGGCGCAAAGGTTAGACGCTCTTCATGCGCGCCTTGATACTCATATTCCCTTCTTTATG
GAGGAAATGCTCGAGAGATATCCAAAGATGAAGAACCGGAATTATGTTCATCAGGGAGACGAAAAAGACCAACTG
TTCCGGACGGAGTATGAGCACGCAGGTGGATCAGACTGTGGGCACTGCCACCCGATCCAGGCCATTGAACGTGTG
CCACGAGAGGATTCGACGCCAGCCATTCACTATGGAACTATCGGGTCTTCCAAGACCCTTCTCAGAGACAGTGTG
AGAAGGGAGATTCTGAAAGCCGACTTCGATATTCTGTGTGTTGAGACGGAAGCAGCGACGTTGATGAACGAGATC
CCTTGTCTGGTAGTCTGTGGCATCAGTGACTATGCAGATTCACATAGTAACACGACATGGCAGCCATACGCTGCT
GCTACGGCTGCTGCATATGCCAAGGAGTTGCTTTCGCTGATTCCTCCTCTGAGCAAGCCTTCAAAAGACAACATC
GAAGTGGCTCCGTTTGCATCGAAACAGCAAGCTCCCACTATTCCAACACCTAGAATTAAATACTTGATTCATGAT
CCGGTCGCTGGTGATTTAGTAGCTGGAAGGAACTTGTTCAGCAGTGGAATCTATCCTGATGGCAAGATGGAAAGG
TGCATATATGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail