Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9836.t1
Gene name
Locationscaffold_097:75375..77068
Strand-
Gene length (bp)1693
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 2.1E-16 154 448

GO

GO Term Description Terminal node
GO:0008194 UDP-glycosyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016757 glycosyltransferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 497 519 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9836.t1
MAMSDIILPPRKILLVVTGGGYTHAAPVLELGKVLANRGHVVDFATLDGQEEWASGFQISSTHLMGPGPTEEQLD
AHYMRSRLWDPARGLGDVMESKYLFDSLWTQSYYGLKTIMDDPATRPDMLVADFFVDAVKDIQLEYKVPIAIVWP
QMPYLMVPCSYIPGQPGFQLDMTLTSENASMWSRINNELVVVRALPEVFKLRNWTRAMRKRAGLNYLLPTPKKPN
YLLLVNSFFGLEVPKDLPPLVAAVGPILADEYPLLDAPHQEFLDRHPKTIYIALGTHIILPHADARKILQGLIQA
MEEGVIDGVIWSVGRSGRQLFDNAESFTMQGKTISFGDLLEGLHADWKFPFFAPQRSILDHPHTRIYFTHGGGSS
ANEGLYHGKPMLVMSFFFDQIGNAAKLAGNGTSELLHKFRFTADELYFKTKLIMEDRDGCYARNVQRLQRIAHVA
SRRKYLGADLIEEVLYDNESRVVDGKETRPMHLQTADMRMPAYKAKNWDLMAVSGVVMGLLGGGLYYAGRLAWIN
RRAIDGFVDGLVCKIYN*
Coding >Ani_SJS100_1|g9836.t1
ATGGCTATGTCGGACATCATTCTGCCACCCAGGAAGATTCTCCTGGTAGTTACTGGAGGAGGCTACACCCATGCC
GCTCCGGTTCTTGAACTGGGGAAGGTCCTGGCCAACCGAGGGCACGTAGTCGACTTCGCAACGCTCGATGGCCAA
GAGGAATGGGCCAGCGGCTTCCAAATCTCGTCGACGCATCTCATGGGGCCTGGGCCGACAGAGGAACAGCTTGAT
GCGCACTACATGCGCAGCCGGCTCTGGGATCCGGCCAGAGGTTTAGGCGATGTCATGGAGTCCAAGTACCTCTTC
GACTCTCTGTGGACACAATCCTATTATGGACTGAAAACTATCATGGATGATCCTGCTACACGGCCGGATATGCTG
GTTGCTGACTTCTTCGTCGACGCAGTCAAGGACATCCAACTGGAATACAAGGTGCCCATTGCTATTGTCTGGCCA
CAGATGCCCTACTTGATGGTTCCCTGCTCGTATATCCCCGGTCAGCCGGGCTTCCAACTCGATATGACCTTAACC
TCGGAGAATGCGTCAATGTGGTCGCGCATCAACAATGAACTTGTAGTCGTGCGGGCCTTGCCTGAGGTGTTTAAA
CTGAGGAACTGGACCAGAGCCATGCGCAAGCGGGCGGGTCTGAATTACCTTCTTCCAACGCCAAAGAAACCTAAT
TATCTACTTCTAGTCAACTCTTTCTTCGGTCTCGAAGTGCCCAAAGACCTTCCTCCCTTGGTCGCAGCAGTCGGA
CCAATATTAGCAGATGAGTATCCTCTATTGGACGCGCCCCACCAGGAGTTCCTTGACCGCCACCCAAAGACCATA
TATATTGCCTTGGGGACGCATATCATCCTCCCCCACGCAGATGCTCGGAAGATTCTTCAAGGACTTATCCAAGCC
ATGGAAGAAGGTGTTATTGACGGCGTAATTTGGTCAGTGGGTAGGAGCGGACGGCAGCTGTTCGACAATGCGGAA
TCCTTCACTATGCAAGGCAAGACAATTAGCTTCGGAGACCTTCTCGAAGGGTTACACGCCGACTGGAAGTTCCCT
TTCTTTGCACCACAACGGTCGATCCTGGATCATCCCCATACCCGCATCTATTTCACCCACGGAGGTGGGTCCAGC
GCCAACGAAGGCCTCTACCATGGCAAACCGATGCTAGTAATGTCATTCTTCTTCGACCAGATCGGTAATGCGGCA
AAACTGGCCGGAAACGGAACGTCGGAGCTGCTACACAAGTTCCGTTTCACGGCCGATGAACTCTACTTCAAGACA
AAATTGATCATGGAAGATCGTGACGGGTGCTATGCGCGCAATGTGCAGCGTCTCCAGCGTATTGCCCATGTGGCG
TCTCGACGCAAATATTTGGGCGCTGATCTGATCGAGGAAGTTCTATACGATAATGAGTCGAGGGTCGTTGATGGG
AAGGAGACTCGTCCAATGCATCTGCAGACGGCGGATATGCGGATGCCAGCTTATAAGGCGAAGAACTGGGACTTG
ATGGCCGTCTCGGGGGTAGTGATGGGGTTGCTTGGTGGGGGCTTGTACTATGCTGGACGGCTCGCTTGGATCAAT
CGCCGGGCTATTGATGGATTTGTTGACGGTTTGGTTTGCAAAATTTATAATTAG
Transcript >Ani_SJS100_1|g9836.t1
ATGGCTATGTCGGACATCATTCTGCCACCCAGGAAGATTCTCCTGGTAGTTACTGGAGGAGGCTACACCCATGCC
GCTCCGGTTCTTGAACTGGGGAAGGTCCTGGCCAACCGAGGGCACGTAGTCGACTTCGCAACGCTCGATGGCCAA
GAGGAATGGGCCAGCGGCTTCCAAATCTCGTCGACGCATCTCATGGGGCCTGGGCCGACAGAGGAACAGCTTGAT
GCGCACTACATGCGCAGCCGGCTCTGGGATCCGGCCAGAGGTTTAGGCGATGTCATGGAGTCCAAGTACCTCTTC
GACTCTCTGTGGACACAATCCTATTATGGACTGAAAACTATCATGGATGATCCTGCTACACGGCCGGATATGCTG
GTTGCTGACTTCTTCGTCGACGCAGTCAAGGACATCCAACTGGAATACAAGGTGCCCATTGCTATTGTCTGGCCA
CAGATGCCCTACTTGATGGTTCCCTGCTCGTATATCCCCGGTCAGCCGGGCTTCCAACTCGATATGACCTTAACC
TCGGAGAATGCGTCAATGTGGTCGCGCATCAACAATGAACTTGTAGTCGTGCGGGCCTTGCCTGAGGTGTTTAAA
CTGAGGAACTGGACCAGAGCCATGCGCAAGCGGGCGGGTCTGAATTACCTTCTTCCAACGCCAAAGAAACCTAAT
TATCTACTTCTAGTCAACTCTTTCTTCGGTCTCGAAGTGCCCAAAGACCTTCCTCCCTTGGTCGCAGCAGTCGGA
CCAATATTAGCAGATGAGTATCCTCTATTGGACGCGCCCCACCAGGAGTTCCTTGACCGCCACCCAAAGACCATA
TATATTGCCTTGGGGACGCATATCATCCTCCCCCACGCAGATGCTCGGAAGATTCTTCAAGGACTTATCCAAGCC
ATGGAAGAAGGTGTTATTGACGGCGTAATTTGGTCAGTGGGTAGGAGCGGACGGCAGCTGTTCGACAATGCGGAA
TCCTTCACTATGCAAGGCAAGACAATTAGCTTCGGAGACCTTCTCGAAGGGTTACACGCCGACTGGAAGTTCCCT
TTCTTTGCACCACAACGGTCGATCCTGGATCATCCCCATACCCGCATCTATTTCACCCACGGAGGTGGGTCCAGC
GCCAACGAAGGCCTCTACCATGGCAAACCGATGCTAGTAATGTCATTCTTCTTCGACCAGATCGGTAATGCGGCA
AAACTGGCCGGAAACGGAACGTCGGAGCTGCTACACAAGTTCCGTTTCACGGCCGATGAACTCTACTTCAAGACA
AAATTGATCATGGAAGATCGTGACGGGTGCTATGCGCGCAATGTGCAGCGTCTCCAGCGTATTGCCCATGTGGCG
TCTCGACGCAAATATTTGGGCGCTGATCTGATCGAGGAAGTTCTATACGATAATGAGTCGAGGGTCGTTGATGGG
AAGGAGACTCGTCCAATGCATCTGCAGACGGCGGATATGCGGATGCCAGCTTATAAGGCGAAGAACTGGGACTTG
ATGGCCGTCTCGGGGGTAGTGATGGGGTTGCTTGGTGGGGGCTTGTACTATGCTGGACGGCTCGCTTGGATCAAT
CGCCGGGCTATTGATGGATTTGTTGACGGTTTGGTTTGCAAAATTTATAATTAG
Gene >Ani_SJS100_1|g9836.t1
ATGGCTATGTCGGACATCATTCTGCCACCCAGGAAGATTCTCCTGGTAGTTACTGGAGGAGGCTACACCCATGCC
GGTGAGTATGCCTGCCTATTGTTTGGCCTTATAGATTCTAATTGGATACAAATGGTTCATTGCAGCTCCGGTTCT
TGAACTGGGGAAGGTCCTGGCCAACCGAGGGCACGTAGTCGACTTCGCAACGCTCGATGGCCAAGAGGAATGGGC
CAGCGGCTTCCAAATCTCGTCGACGCATCTCATGGGGCCTGGGCCGACAGAGGAACAGCTTGATGCGCACTACAT
GCGCAGCCGGCTCTGGGATCCGGCCAGAGGTTTAGGCGATGTCATGGAGTCCAAGTACCTCTTCGACTCTCTGTG
GACACAATCCTATTATGGACTGAAAACTATCATGGATGATCCTGCTACACGGCCGGATATGCTGGTTGCTGACTT
CTTCGTCGACGCAGTCAAGGACATCCAACTGGAATACAAGGTGCCCATTGCTATTGTCTGGCCACAGATGCCCTA
CTTGATGGTTCCCTGCTCGTATATCCCCGGTCAGCCGGGCTTCCAACTCGATATGACCTTAACCTCGGAGAATGC
GTCAATGTGGTCGCGCATCAACAATGAACTTGTAGTCGTGCGGGCCTTGCCTGAGGTGTTTAAACTGAGGAACTG
GACCAGAGCCATGCGCAAGCGGGCGGGTCTGAATTACCTTCTTCCAACGCCAAAGAAACCTAATTATCTACTTCT
AGTCAACTCTTTCTTCGGTCTCGAAGTGCCCAAAGACCTTCCTCCCTTGGTCGCAGCAGTCGGACCAATATTAGC
AGATGAGTATCCTCTATTGGACGCGCCCCACCAGGAGTTCCTTGACCGCCACCCAAAGACCATATATATTGCCTT
GGGGACGCATATCATCCTCCCCCACGCAGATGCTCGGAAGATTCTTCAAGGACTTATCCAAGCCATGGAAGAAGG
TGTTATTGACGGCGTAATTTGGTCAGTGGGTAGGAGCGGACGGCAGCTGTTCGACAATGCGGAATCCTTCACTAT
GCAAGGCAAGACAATTAGCTTCGGAGACCTTCTCGAAGGGTTACACGCCGACTGGAAGTTCCCTTTCTTTGCACC
ACAACGGTCGATCCTGGATCATCCCCATACCCGCATCTATTTCACCCACGGAGGTGGGTCCAGCGCCAACGAAGG
CCTCTACCATGGCAAACCGATGCTAGTAATGTCATTCTTCTTCGACCAGATCGGTAATGCGGCAAAACTGGCCGG
AAACGGAACGTCGGAGCTGCTACACAAGTTCCGTTTCACGGCCGATGAACTCTACTTCAAGACAAAATTGATCAT
GGAAGATCGTGACGGGTGCTATGCGCGCAATGTGCAGCGTCTCCAGCGTATTGCCCATGTGGCGTCTCGACGCAA
ATATTTGGGCGCTGATCTGATCGAGGAAGTTCTATACGATAATGAGTCGAGGGTCGTTGATGGGAAGGAGACTCG
TCCAATGCATCTGCAGACGGCGGATATGCGGATGCCAGCTTATAAGGCGAAGAACTGGGACTTGATGGCCGTCTC
GGGGGTAGTGATGGGGTTGCTTGGTGGGGGCTTGTACTATGCTGGACGGCTCGCTTGGATCAATCGCCGGGCTAT
TGATGGATTTGTTGACGGTTTGGTTTGCAAAATTTATAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail