Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g977.t1
Gene name
Locationscaffold_003:491934..492683
Strand+
Gene length (bp)749
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 9.9E-25 22 204

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g977.t1
METLKAVFFGPDPQTQMRKCNQLIRANTRQLDRDIAQLKTLESKTRQYIMNSSKRAQRNPSQAKQANMEAKTFAR
ELVRIRKQSTRLHTSRAQLQSVQMQVNEAFSVRKIQGSLKKSTGIMKDVNTLVRMPELNATMRQLSTELVRAGII
EEMVDDAIPNNELLEEEEEEAEEEVDKVLQEILHGKLSQVEGVQPEKPLEEAPEPEDEFADQEATLEQMRGRLEA
LKS*
Coding >Ani_SJS100_1|g977.t1
ATGGAGACCCTCAAAGCAGTCTTTTTCGGCCCGGATCCTCAAACACAGATGAGAAAATGTAACCAGCTCATCCGC
GCCAATACCCGACAGTTGGATCGTGACATCGCACAACTGAAGACTCTGGAAAGCAAGACACGACAATACATTATG
AATTCGTCGAAGCGGGCCCAACGCAATCCCTCCCAGGCCAAGCAGGCCAACATGGAGGCCAAGACCTTTGCACGA
GAGCTTGTTCGCATTCGCAAGCAGTCTACCCGGTTACATACCAGTCGCGCGCAACTGCAGAGTGTTCAGATGCAG
GTCAATGAGGCCTTCTCGGTTCGGAAGATTCAGGGCAGCTTGAAGAAATCGACGGGGATTATGAAGGACGTCAAC
ACATTGGTCCGGATGCCCGAGCTGAATGCCACGATGCGTCAGCTTTCGACGGAACTGGTGCGGGCCGGGATCATC
GAGGAGATGGTCGATGACGCCATTCCTAACAACGAGTTACTGGAGGAAGAGGAAGAGGAAGCAGAGGAGGAGGTC
GACAAGGTCCTGCAGGAGATCCTCCATGGCAAGTTGTCTCAGGTCGAAGGGGTCCAGCCCGAGAAGCCATTGGAA
GAGGCTCCGGAGCCAGAGGACGAGTTCGCGGATCAAGAAGCGACACTAGAGCAGATGCGAGGACGGCTCGAAGCC
TTGAAGAGCTGA
Transcript >Ani_SJS100_1|g977.t1
ATGGAGACCCTCAAAGCAGTCTTTTTCGGCCCGGATCCTCAAACACAGATGAGAAAATGTAACCAGCTCATCCGC
GCCAATACCCGACAGTTGGATCGTGACATCGCACAACTGAAGACTCTGGAAAGCAAGACACGACAATACATTATG
AATTCGTCGAAGCGGGCCCAACGCAATCCCTCCCAGGCCAAGCAGGCCAACATGGAGGCCAAGACCTTTGCACGA
GAGCTTGTTCGCATTCGCAAGCAGTCTACCCGGTTACATACCAGTCGCGCGCAACTGCAGAGTGTTCAGATGCAG
GTCAATGAGGCCTTCTCGGTTCGGAAGATTCAGGGCAGCTTGAAGAAATCGACGGGGATTATGAAGGACGTCAAC
ACATTGGTCCGGATGCCCGAGCTGAATGCCACGATGCGTCAGCTTTCGACGGAACTGGTGCGGGCCGGGATCATC
GAGGAGATGGTCGATGACGCCATTCCTAACAACGAGTTACTGGAGGAAGAGGAAGAGGAAGCAGAGGAGGAGGTC
GACAAGGTCCTGCAGGAGATCCTCCATGGCAAGTTGTCTCAGGTCGAAGGGGTCCAGCCCGAGAAGCCATTGGAA
GAGGCTCCGGAGCCAGAGGACGAGTTCGCGGATCAAGAAGCGACACTAGAGCAGATGCGAGGACGGCTCGAAGCC
TTGAAGAGCTGA
Gene >Ani_SJS100_1|g977.t1
ATGGAGACCCTCAAAGCAGTCTTTTTCGGCCCGGATCCTCAAACACAGGCAAGTGCCGATTTTGTCCAGCCACAA
TGTCTGGCGCTTCTGACCGTGATTGCTGTCTCTAGATGAGAAAATGTAACCAGCTCATCCGCGCCAATACCCGAC
AGTTGGATCGTGACATCGCACAACTGAAGACTCTGGAAAGCAAGACACGACAATACATTATGAATTCGTCGAAGC
GGGCCCAACGCAATCCCTCCCAGGCCAAGCAGGCCAACATGGAGGCCAAGACCTTTGCACGAGAGCTTGTTCGCA
TTCGCAAGCAGTCTACCCGGTTACATACCAGTCGCGCGCAACTGCAGAGTGTTCAGATGCAGGTCAATGAGGCCT
TCTCGGTTCGGAAGATTCAGGGCAGCTTGAAGAAATCGACGGGGATTATGAAGGACGTCAACACATTGGTCCGGA
TGCCCGAGCTGAATGCCACGATGCGTCAGCTTTCGACGGAACTGGTGCGGGCCGGGATCATCGAGGAGATGGTCG
ATGACGCCATTCCTAACAACGAGTTACTGGAGGAAGAGGAAGAGGAAGCAGAGGAGGAGGTCGACAAGGTCCTGC
AGGAGATCCTCCATGGCAAGTTGTCTCAGGTCGAAGGGGTCCAGCCCGAGAAGCCATTGGAAGAGGCTCCGGAGC
CAGAGGACGAGTTCGCGGATCAAGAAGCGACACTAGAGCAGATGCGAGGACGGCTCGAAGCCTTGAAGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail