Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9652.t1
Gene name
Locationscaffold_092:25837..27780
Strand+
Gene length (bp)1943
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04137 ERO1 Endoplasmic Reticulum Oxidoreductin 1 (ERO1) 1.7E-137 56 453

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0016972 thiol oxidase activity Yes
GO:0005783 endoplasmic reticulum Yes
GO:0015035 protein-disulfide reductase activity Yes
GO:0034975 protein folding in endoplasmic reticulum Yes
GO:0050660 flavin adenine dinucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0015036 disulfide oxidoreductase activity No
GO:0043226 organelle No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0000166 nucleotide binding No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0097159 organic cyclic compound binding No
GO:0006457 protein folding No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9652.t1
MRSAAKFFYLAVFALSRLSNAETGLHHNQDKCAIDPTAMVSDACVSYATIDHLNDQVYTLLQSITQDTDFFSYYR
LNLFNKVCPFWSDANSMCGNIACSVNTIESEDDIPLTWRAEELSKLEGPKAGHPGRNQRKERPLNRPLQGMLGEN
VGESCVVEYDDECDERDYCVPEDEGASGKGDYVSLVDNPERFTGYAGMGAHQVWDAIYRENCFLKPVPELSPVTP
QLGGLQAVNDFRHVLQQELKRPDLLPLDNECLEKRVFHRLISGMHASISTHLCWDYLNQTTGQWHPNLQCFKDRL
HDHPERISNLYFNYALVSRAVAKLQKHLHNYNYCVGDPVQDAMTREKVSKLTSTLADRPQIFDENVMFQDPSSAG
LKEDFRNRFRNVSRLMDCVGCDKCRLWGKLQVNGYGTALKVLFEYDETKNGENPLLRRTELVALINTLGRISHSI
AAVRSFHRAMDVGDGEVFTIPASIASKERGGKKKTRRLLKDGGSTFYYEDGDDDNFVYITEKLPWEKVRVRRDTD
TVWDDIKAEFSMIWDIYVYVLKSWVNAPKTFFEIAVLEVARVWNYWLGLPVPPRSWRIQLPKRPTPPTPPTHEEL
*
Coding >Ani_SJS100_1|g9652.t1
ATGCGCTCCGCAGCCAAATTTTTCTATTTGGCGGTATTTGCCCTGTCGAGGCTTTCCAATGCCGAGACTGGGCTG
CACCATAACCAGGACAAGTGTGCGATTGACCCCACTGCCATGGTGTCCGACGCTTGTGTCTCCTACGCCACTATC
GATCATCTGAACGATCAAGTCTACACCCTCCTCCAATCCATTACGCAAGATACCGATTTCTTCTCGTACTACCGT
CTTAATCTCTTCAACAAAGTCTGTCCGTTCTGGTCCGATGCGAATAGTATGTGCGGGAACATTGCATGCTCCGTC
AACACAATCGAATCTGAAGACGACATTCCGTTAACATGGCGCGCGGAGGAGCTCAGTAAACTCGAGGGACCCAAA
GCAGGCCATCCGGGCCGCAATCAACGAAAGGAGCGACCTCTTAATCGACCGCTCCAAGGAATGCTAGGCGAAAAT
GTTGGAGAGAGCTGTGTGGTGGAGTATGACGATGAATGTGATGAACGGGACTACTGTGTTCCCGAAGATGAGGGT
GCTAGCGGCAAGGGAGACTATGTCAGTCTCGTTGATAATCCAGAACGGTTCACAGGGTATGCCGGTATGGGCGCC
CATCAGGTTTGGGATGCAATCTATCGGGAGAATTGCTTCCTCAAACCGGTGCCCGAGCTATCACCCGTTACTCCT
CAGCTGGGTGGTCTTCAAGCTGTCAACGATTTCCGTCATGTGCTTCAGCAGGAGTTGAAGCGCCCTGACCTGCTT
CCATTGGACAATGAATGCCTTGAGAAGCGAGTGTTCCATCGTCTCATCAGCGGAATGCATGCGTCTATCTCGACC
CACCTTTGCTGGGACTACCTAAACCAGACGACGGGACAATGGCATCCTAACCTTCAATGCTTCAAAGATCGTCTC
CACGATCACCCCGAGCGCATCTCGAACCTGTACTTCAACTACGCGCTGGTCTCGCGCGCCGTGGCGAAGCTGCAG
AAACACCTACACAACTACAACTACTGCGTCGGTGATCCGGTCCAGGATGCCATGACTAGGGAGAAGGTCTCCAAG
TTGACCTCGACCTTGGCTGACCGCCCTCAAATTTTCGACGAGAACGTCATGTTCCAGGATCCCAGCTCCGCTGGC
CTGAAGGAAGACTTCCGCAACCGATTCCGCAACGTCAGTCGCCTGATGGACTGCGTCGGGTGCGACAAATGCCGC
CTCTGGGGCAAGCTCCAGGTCAACGGATATGGCACCGCTCTGAAAGTGCTGTTCGAGTACGACGAGACTAAGAAC
GGCGAGAACCCGTTGCTGCGCCGGACTGAGCTGGTGGCACTGATCAATACCCTTGGTCGCATTTCTCACAGCATT
GCCGCCGTCCGGAGTTTCCACCGGGCCATGGATGTGGGCGATGGGGAGGTCTTCACCATCCCCGCGAGCATTGCG
TCCAAGGAGCGCGGTGGCAAGAAGAAGACCCGACGACTTCTCAAAGACGGTGGCTCAACCTTCTATTATGAGGAT
GGCGATGATGACAACTTTGTCTACATCACCGAGAAACTTCCGTGGGAGAAGGTCCGGGTACGCCGCGACACGGAT
ACGGTCTGGGATGATATTAAGGCCGAGTTTTCTATGATCTGGGACATTTACGTCTATGTGCTGAAGAGCTGGGTC
AATGCACCAAAGACATTCTTCGAGATCGCCGTCCTGGAGGTTGCTCGGGTATGGAACTACTGGCTGGGTCTGCCT
GTGCCGCCACGGTCCTGGAGGATCCAGCTTCCCAAGCGACCCACCCCTCCAACACCCCCGACCCATGAGGAGCTC
TAG
Transcript >Ani_SJS100_1|g9652.t1
ATGCGCTCCGCAGCCAAATTTTTCTATTTGGCGGTATTTGCCCTGTCGAGGCTTTCCAATGCCGAGACTGGGCTG
CACCATAACCAGGACAAGTGTGCGATTGACCCCACTGCCATGGTGTCCGACGCTTGTGTCTCCTACGCCACTATC
GATCATCTGAACGATCAAGTCTACACCCTCCTCCAATCCATTACGCAAGATACCGATTTCTTCTCGTACTACCGT
CTTAATCTCTTCAACAAAGTCTGTCCGTTCTGGTCCGATGCGAATAGTATGTGCGGGAACATTGCATGCTCCGTC
AACACAATCGAATCTGAAGACGACATTCCGTTAACATGGCGCGCGGAGGAGCTCAGTAAACTCGAGGGACCCAAA
GCAGGCCATCCGGGCCGCAATCAACGAAAGGAGCGACCTCTTAATCGACCGCTCCAAGGAATGCTAGGCGAAAAT
GTTGGAGAGAGCTGTGTGGTGGAGTATGACGATGAATGTGATGAACGGGACTACTGTGTTCCCGAAGATGAGGGT
GCTAGCGGCAAGGGAGACTATGTCAGTCTCGTTGATAATCCAGAACGGTTCACAGGGTATGCCGGTATGGGCGCC
CATCAGGTTTGGGATGCAATCTATCGGGAGAATTGCTTCCTCAAACCGGTGCCCGAGCTATCACCCGTTACTCCT
CAGCTGGGTGGTCTTCAAGCTGTCAACGATTTCCGTCATGTGCTTCAGCAGGAGTTGAAGCGCCCTGACCTGCTT
CCATTGGACAATGAATGCCTTGAGAAGCGAGTGTTCCATCGTCTCATCAGCGGAATGCATGCGTCTATCTCGACC
CACCTTTGCTGGGACTACCTAAACCAGACGACGGGACAATGGCATCCTAACCTTCAATGCTTCAAAGATCGTCTC
CACGATCACCCCGAGCGCATCTCGAACCTGTACTTCAACTACGCGCTGGTCTCGCGCGCCGTGGCGAAGCTGCAG
AAACACCTACACAACTACAACTACTGCGTCGGTGATCCGGTCCAGGATGCCATGACTAGGGAGAAGGTCTCCAAG
TTGACCTCGACCTTGGCTGACCGCCCTCAAATTTTCGACGAGAACGTCATGTTCCAGGATCCCAGCTCCGCTGGC
CTGAAGGAAGACTTCCGCAACCGATTCCGCAACGTCAGTCGCCTGATGGACTGCGTCGGGTGCGACAAATGCCGC
CTCTGGGGCAAGCTCCAGGTCAACGGATATGGCACCGCTCTGAAAGTGCTGTTCGAGTACGACGAGACTAAGAAC
GGCGAGAACCCGTTGCTGCGCCGGACTGAGCTGGTGGCACTGATCAATACCCTTGGTCGCATTTCTCACAGCATT
GCCGCCGTCCGGAGTTTCCACCGGGCCATGGATGTGGGCGATGGGGAGGTCTTCACCATCCCCGCGAGCATTGCG
TCCAAGGAGCGCGGTGGCAAGAAGAAGACCCGACGACTTCTCAAAGACGGTGGCTCAACCTTCTATTATGAGGAT
GGCGATGATGACAACTTTGTCTACATCACCGAGAAACTTCCGTGGGAGAAGGTCCGGGTACGCCGCGACACGGAT
ACGGTCTGGGATGATATTAAGGCCGAGTTTTCTATGATCTGGGACATTTACGTCTATGTGCTGAAGAGCTGGGTC
AATGCACCAAAGACATTCTTCGAGATCGCCGTCCTGGAGGTTGCTCGGGTATGGAACTACTGGCTGGGTCTGCCT
GTGCCGCCACGGTCCTGGAGGATCCAGCTTCCCAAGCGACCCACCCCTCCAACACCCCCGACCCATGAGGAGCTC
TAG
Gene >Ani_SJS100_1|g9652.t1
ATGCGCTCCGCAGCCAAATTTTTCTATTTGGCGGTATTTGCCCTGTCGAGGCTTTCCAATGCCGAGACTGGGCTG
CACCATAACCAGGACAAGTGTGCGGTAAGTCGATACAACGCTCGGGCATACGCTTGGACTGCATGTTGTAGACCG
GACTTGGCTGATTCATTCTCATCTCTACCAGATTGACCCCACTGCCATGGTGTCCGACGCTTGTGTCTCCTACGC
CACTATCGATCATCTGAACGATCAAGTCTACACCCTCCTCCAATCCATTACGCAAGATACCGATTTCTTCTCGTA
CTACCGTCTTAATCTCTTCAACAAAGTCTGTCCGTTCTGGTCCGATGCGAATAGTATGTGCGGGAACATTGCATG
CTCCGTCAACACAATCGAATCTGAAGACGACATTCCGTTAACATGGCGCGCGGAGGAGCTCAGTAAACTCGAGGG
ACCCAAAGCAGGCCATCCGGGCCGCAATCAACGAAAGGAGCGACCTCTTAATCGACCGCTCCAAGGAATGCTAGG
CGAAAATGTTGGAGAGAGCTGTGTGGTGGAGTATGACGATGAATGTGATGAACGGGACTACTGTGTTCCCGAAGA
TGAGGGTGCTAGCGGCAAGGGAGACTATGTCAGTCTCGTTGATAATCCAGAACGGTTCACAGGGTATGCCGGTAT
GGGCGCCCATCAGGTTTGGGATGCAATCTATCGGGAGAATTGCTTCCTCAAACCGGTGCCCGAGCTATCACCCGT
TACTCCTCAGCTGGGTGGTCTTCAAGCTGTCAACGATTTCCGTCATGTGCTTCAGCAGGAGTTGAAGCGCCCTGA
CCTGCTTCCATTGGACAATGAATGCCTTGAGAAGCGAGTGTTCCATCGTCTCATCAGCGGAATGCATGCGTCTAT
CTCGACCCACCTTTGCTGGGACTACCTAAACCAGACGACGGGACAATGGCATCCTAACCTTCAATGCTTCAAAGA
TCGTCTCCACGATCACCCCGAGCGCATCTCGAACCTGTACTTCAACTACGCGCTGGTCTCGCGCGCCGTGGCGAA
GCTGCAGAAACACCTACACAACTACAACTACTGCGTCGGTGATCCGGTCCAGGATGCCATGACTAGGGAGAAGGT
CTCCAAGTTGACCTCGACCTTGGCTGACCGCCCTCAAATTTTCGACGAGAACGTCATGTTCCAGGATCCCAGCTC
CGCTGGCCTGAAGGAAGACTTCCGCAACCGATTCCGCAACGTCAGTCGCCTGATGGACTGCGTCGGGTGCGACAA
ATGCCGCCTCTGGGGCAAGCTCCAGGTCAACGGATATGGCACCGCTCTGAAAGTGCTGTTCGAGTACGACGAGAC
TAAGAACGGCGAGAACCCGTTGCTGCGCCGGACTGAGCTGGTGGCACTGATCAATACCCTTGGTCGCATTTCTCA
CAGCATTGCCGCCGTCCGGAGTTTCCACCGGGCCATGGATGTGGGCGATGGGGAGGTCTTCACCATCCCCGCGAG
CATTGCGTCCAAGGAGCGCGGTGGCAAGAAGAAGACCCGACGACTTCTCAAAGACGGTGGCTCAACCTTCTATTA
TGAGGATGGCGATGATGACAACTTTGTCTACATCACCGAGAAACTTCCGTGGGAGAAGGTCCGGGTACGCCGCGA
CACGGATACGGTCTGGGATGATATTAAGGCCGAGTTTTCTATGATCTGGGACATTTACGTCTATGTGCTGAAGAG
CTGGGTCAATGCACCAAAGACATTGTAAGTGATGGCATACGATGACCTCCACAGTTTCCTATATACTAACTGGGC
ATTGCAGCTTCGAGATCGCCGTCCTGGAGGTTGCTCGGGTATGGAACTACTGGCTGGGTCTGCCTGTGCCGCCAC
GGTCCTGGAGGATCCAGCTTCCCAAGCGACCCACCCCTCCAACACCCCCGACCCATGAGGAGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail