Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9631.t1
Gene name
Locationscaffold_091:80762..83440
Strand-
Gene length (bp)2678
Transcript length (bp)2202
Coding sequence length (bp)2202
Protein length (aa) 734

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05064 Nsp1_C Nsp1-like C-terminal region 7.2E-42 503 610
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.3E+00 50 138
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 2.3E-03 100 185
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 3.5E-02 148 270
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.0E+00 236 313
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 6.3E+00 279 376
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 7.1E+01 373 464

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9631.t1
MDMKRGDDAVLLIVGFDGILSPGAGSPVNPRCYPPNTMSNLFSFDSAPGGANKGGLFGSGATNTGSSAGSGTLFG
NVGAPTSGTSSPSLFGGAAGSGTGAGTGTSSPFSFGAQSKPGATSQTPLFGNASQTPNKSTEAGSSGQTATSGLF
GNAAKPAGGLFGNATSTPGQTGGSLFGNASSTTPAGPPPQGATGQTQTLFGQAAQKPGGLFGNVNSTTSTTSTTS
SAAPSSTTATAPATTTPSLFGNANTNTTTSTSNTTQQPSTGGLFGGANTAQKPLFGTNPAPSTGNSLFGNAKPAA
PSTNDSTPNTLFGKAPGAPSTTTTPATGGGAGAQTSSLFKAPASGADATKPVFPSLGTPSSTPQTSTTPAASSAA
PQTSSLFPALGGASSSATPSSTPAPSGGLFGGALGGAKSTATTAPATTATAAPATQPAAATGGLFGKPAETTPST
QPASTAAGASATTAGDKPTLTATSGATSSATTGTAGATGTTTATGGIGLGASTAGPTPPAQSRLKNKTMDEIITR
WATDLTKYQKDFREQAEKVAEWDRMLVENGTKVQKLYGSTVDAERATQEVERQLASVEGQQEELSSWLDRYEREV
DEMISKQVGPGETLQGPDQERERTYKMAEKLSERLDEMGKDLTSMIEEVNGASSTLSKTNKADEPISQIVRILNS
HLAQLQVIDQGTTELQAKVDAAQKAGQSLSSRFGYGLGSSSVGGSAADDFYRSYMGRR*
Coding >Ani_SJS100_1|g9631.t1
ATGGATATGAAACGGGGGGACGATGCTGTCCTTCTGATCGTCGGGTTCGATGGCATCTTATCTCCGGGCGCAGGC
AGCCCTGTTAATCCCCGTTGCTATCCACCCAACACCATGTCCAACCTCTTTTCTTTCGACTCGGCCCCTGGCGGC
GCGAACAAGGGGGGTCTTTTTGGATCTGGTGCCACGAACACTGGCTCTAGCGCTGGCTCGGGCACACTCTTTGGA
AACGTAGGTGCTCCGACGAGCGGCACTTCTTCGCCTTCTTTGTTCGGGGGCGCAGCTGGCAGTGGAACTGGAGCG
GGTACTGGTACTTCGTCGCCTTTCAGTTTCGGAGCTCAGAGCAAGCCGGGGGCCACCAGTCAGACACCGTTGTTC
GGCAACGCATCACAGACTCCCAACAAGTCGACCGAAGCTGGTAGCTCAGGGCAAACAGCTACGAGCGGACTCTTT
GGCAATGCCGCAAAGCCTGCAGGGGGCCTCTTTGGCAACGCTACTTCTACGCCCGGTCAAACAGGAGGTTCTTTG
TTCGGCAATGCCTCGTCCACAACGCCCGCCGGTCCTCCTCCGCAGGGCGCGACTGGCCAGACGCAGACGCTCTTT
GGACAGGCAGCACAAAAGCCTGGCGGTCTCTTCGGAAACGTGAACTCGACCACCTCGACTACCTCGACCACCTCA
TCGGCTGCCCCGTCGTCTACTACCGCTACAGCCCCCGCCACCACTACCCCGTCGCTGTTCGGAAACGCCAACACA
AACACCACAACCTCTACCTCCAACACTACGCAACAGCCATCAACTGGGGGTCTCTTCGGTGGGGCGAACACAGCG
CAGAAACCTCTCTTTGGTACCAATCCGGCGCCTTCTACGGGAAATAGCCTGTTCGGAAACGCCAAACCGGCCGCA
CCAAGCACCAATGACAGCACTCCAAACACCCTCTTTGGAAAGGCACCGGGGGCACCGTCAACGACGACAACCCCG
GCCACAGGAGGAGGAGCTGGTGCGCAGACATCTTCTCTCTTCAAAGCCCCAGCATCTGGAGCTGATGCCACCAAG
CCAGTCTTCCCCTCTCTGGGCACTCCGTCCTCGACCCCTCAAACCTCTACGACGCCAGCTGCCTCGTCCGCTGCG
CCACAGACTTCCTCTCTTTTCCCAGCCCTAGGTGGAGCGTCCTCGTCCGCGACTCCATCATCAACACCCGCTCCC
TCTGGAGGCTTGTTTGGCGGTGCCCTCGGTGGCGCTAAGTCCACAGCAACCACCGCTCCCGCCACTACAGCTACC
GCAGCTCCCGCGACACAACCTGCGGCAGCCACCGGCGGCCTGTTCGGTAAGCCCGCGGAGACCACCCCGTCCACA
CAGCCAGCCAGCACTGCTGCTGGAGCCTCTGCTACGACGGCTGGCGACAAGCCCACCCTGACCGCTACCTCTGGC
GCCACCTCTTCAGCTACCACCGGTACAGCAGGCGCAACAGGCACAACCACCGCCACTGGCGGAATTGGCCTTGGT
GCCTCGACTGCTGGACCGACTCCTCCGGCGCAGTCCCGCCTGAAGAACAAGACCATGGATGAGATCATCACCCGG
TGGGCGACTGATCTGACCAAGTACCAGAAGGACTTCCGCGAGCAAGCCGAGAAGGTAGCAGAATGGGATCGGATG
CTGGTTGAGAACGGCACCAAGGTGCAGAAACTGTACGGCAGCACGGTGGATGCTGAGCGCGCGACTCAAGAAGTC
GAGCGTCAGCTGGCGTCCGTCGAGGGCCAGCAGGAAGAGCTCAGCTCCTGGCTCGACCGGTACGAGCGTGAAGTG
GACGAGATGATTTCCAAGCAAGTCGGACCGGGTGAAACTCTGCAGGGACCTGACCAGGAGCGTGAACGGACATAC
AAAATGGCCGAGAAGCTCTCCGAGCGCCTGGACGAAATGGGCAAGGATCTGACAAGCATGATTGAGGAAGTCAAC
GGCGCGTCCTCGACTCTCAGCAAGACGAACAAGGCTGACGAGCCGATCTCGCAAATCGTCCGCATCCTCAACTCC
CACCTCGCGCAACTGCAGGTCATCGACCAAGGCACCACGGAGCTCCAGGCCAAGGTCGACGCCGCACAGAAGGCC
GGCCAGTCCCTCTCTTCGCGGTTCGGGTATGGTCTGGGTAGCTCTAGTGTGGGCGGTAGTGCCGCAGATGATTTC
TATCGCTCTTACATGGGACGTCGCTAG
Transcript >Ani_SJS100_1|g9631.t1
ATGGATATGAAACGGGGGGACGATGCTGTCCTTCTGATCGTCGGGTTCGATGGCATCTTATCTCCGGGCGCAGGC
AGCCCTGTTAATCCCCGTTGCTATCCACCCAACACCATGTCCAACCTCTTTTCTTTCGACTCGGCCCCTGGCGGC
GCGAACAAGGGGGGTCTTTTTGGATCTGGTGCCACGAACACTGGCTCTAGCGCTGGCTCGGGCACACTCTTTGGA
AACGTAGGTGCTCCGACGAGCGGCACTTCTTCGCCTTCTTTGTTCGGGGGCGCAGCTGGCAGTGGAACTGGAGCG
GGTACTGGTACTTCGTCGCCTTTCAGTTTCGGAGCTCAGAGCAAGCCGGGGGCCACCAGTCAGACACCGTTGTTC
GGCAACGCATCACAGACTCCCAACAAGTCGACCGAAGCTGGTAGCTCAGGGCAAACAGCTACGAGCGGACTCTTT
GGCAATGCCGCAAAGCCTGCAGGGGGCCTCTTTGGCAACGCTACTTCTACGCCCGGTCAAACAGGAGGTTCTTTG
TTCGGCAATGCCTCGTCCACAACGCCCGCCGGTCCTCCTCCGCAGGGCGCGACTGGCCAGACGCAGACGCTCTTT
GGACAGGCAGCACAAAAGCCTGGCGGTCTCTTCGGAAACGTGAACTCGACCACCTCGACTACCTCGACCACCTCA
TCGGCTGCCCCGTCGTCTACTACCGCTACAGCCCCCGCCACCACTACCCCGTCGCTGTTCGGAAACGCCAACACA
AACACCACAACCTCTACCTCCAACACTACGCAACAGCCATCAACTGGGGGTCTCTTCGGTGGGGCGAACACAGCG
CAGAAACCTCTCTTTGGTACCAATCCGGCGCCTTCTACGGGAAATAGCCTGTTCGGAAACGCCAAACCGGCCGCA
CCAAGCACCAATGACAGCACTCCAAACACCCTCTTTGGAAAGGCACCGGGGGCACCGTCAACGACGACAACCCCG
GCCACAGGAGGAGGAGCTGGTGCGCAGACATCTTCTCTCTTCAAAGCCCCAGCATCTGGAGCTGATGCCACCAAG
CCAGTCTTCCCCTCTCTGGGCACTCCGTCCTCGACCCCTCAAACCTCTACGACGCCAGCTGCCTCGTCCGCTGCG
CCACAGACTTCCTCTCTTTTCCCAGCCCTAGGTGGAGCGTCCTCGTCCGCGACTCCATCATCAACACCCGCTCCC
TCTGGAGGCTTGTTTGGCGGTGCCCTCGGTGGCGCTAAGTCCACAGCAACCACCGCTCCCGCCACTACAGCTACC
GCAGCTCCCGCGACACAACCTGCGGCAGCCACCGGCGGCCTGTTCGGTAAGCCCGCGGAGACCACCCCGTCCACA
CAGCCAGCCAGCACTGCTGCTGGAGCCTCTGCTACGACGGCTGGCGACAAGCCCACCCTGACCGCTACCTCTGGC
GCCACCTCTTCAGCTACCACCGGTACAGCAGGCGCAACAGGCACAACCACCGCCACTGGCGGAATTGGCCTTGGT
GCCTCGACTGCTGGACCGACTCCTCCGGCGCAGTCCCGCCTGAAGAACAAGACCATGGATGAGATCATCACCCGG
TGGGCGACTGATCTGACCAAGTACCAGAAGGACTTCCGCGAGCAAGCCGAGAAGGTAGCAGAATGGGATCGGATG
CTGGTTGAGAACGGCACCAAGGTGCAGAAACTGTACGGCAGCACGGTGGATGCTGAGCGCGCGACTCAAGAAGTC
GAGCGTCAGCTGGCGTCCGTCGAGGGCCAGCAGGAAGAGCTCAGCTCCTGGCTCGACCGGTACGAGCGTGAAGTG
GACGAGATGATTTCCAAGCAAGTCGGACCGGGTGAAACTCTGCAGGGACCTGACCAGGAGCGTGAACGGACATAC
AAAATGGCCGAGAAGCTCTCCGAGCGCCTGGACGAAATGGGCAAGGATCTGACAAGCATGATTGAGGAAGTCAAC
GGCGCGTCCTCGACTCTCAGCAAGACGAACAAGGCTGACGAGCCGATCTCGCAAATCGTCCGCATCCTCAACTCC
CACCTCGCGCAACTGCAGGTCATCGACCAAGGCACCACGGAGCTCCAGGCCAAGGTCGACGCCGCACAGAAGGCC
GGCCAGTCCCTCTCTTCGCGGTTCGGGTATGGTCTGGGTAGCTCTAGTGTGGGCGGTAGTGCCGCAGATGATTTC
TATCGCTCTTACATGGGACGTCGCTAG
Gene >Ani_SJS100_1|g9631.t1
ATGGATATGAAACGGGGGGACGATGCTGTCCTTCTGATCGTCGGGTTCGATGTGAGTCTCGAACGTGGCCTGAGG
CACCAAGAGGCTCAGGCGACATCATCCGAGGCACCAAGGCACCAAGGCAGTCTGCCATGATACGTACAGTAATGC
CTGAGGCATAAAGCTAGCCGCCAGCCGCGACAAGCGCGGCCCAGCAAAGAAGATCAATCGACCTCCAATTCATAG
TTCAAGACATCCACTGTCGATTGTCTCTGCCTGTGTTTGGACGAGCAAGGCGCGACTTTGACACTCAGCCCGAAT
TGACTTTCCTGTCTTCATAGGGCATCTTATCTCCGGGCGCAGTAAGTGTTGGTTCGCTCTCACCTTCAGCTCATC
TCGAAACCCGTCCCGACTGACTGTTTTGTCTTTTTTTCCCACCTCCAGGGCAGCCCTGTTAATCCCCGTTGCTAT
CCACCCAACACCATGTCCAACCTCTTTTCTTTCGACTCGGCCCCTGGCGGCGCGAACAAGGGGGGTCTTTTTGGA
TCTGGTGCCACGAACACTGGCTCTAGCGCTGGCTCGGGCACACTCTTTGGAAACGTAGGTGCTCCGACGAGCGGC
ACTTCTTCGCCTTCTTTGTTCGGGGGCGCAGCTGGCAGTGGAACTGGAGCGGGTACTGGTACTTCGTCGCCTTTC
AGTTTCGGAGCTCAGAGCAAGCCGGGGGCCACCAGTCAGACACCGTTGTTCGGCAACGCATCACAGACTCCCAAC
AAGTCGACCGAAGCTGGTAGCTCAGGGCAAACAGCTACGAGCGGACTCTTTGGCAATGCCGCAAAGCCTGCAGGG
GGCCTCTTTGGCAACGCTACTTCTACGCCCGGTCAAACAGGAGGTTCTTTGTTCGGCAATGCCTCGTCCACAACG
CCCGCCGGTCCTCCTCCGCAGGGCGCGACTGGCCAGACGCAGACGCTCTTTGGACAGGCAGCACAAAAGCCTGGC
GGTCTCTTCGGAAACGTGAACTCGACCACCTCGACTACCTCGACCACCTCATCGGCTGCCCCGTCGTCTACTACC
GCTACAGCCCCCGCCACCACTACCCCGTCGCTGTTCGGAAACGCCAACACAAACACCACAACCTCTACCTCCAAC
ACTACGCAACAGCCATCAACTGGGGGTCTCTTCGGTGGGGCGAACACAGCGCAGAAACCTCTCTTTGGTACCAAT
CCGGCGCCTTCTACGGGAAATAGCCTGTTCGGAAACGCCAAACCGGCCGCACCAAGCACCAATGACAGCACTCCA
AACACCCTCTTTGGAAAGGCACCGGGGGCACCGTCAACGACGACAACCCCGGCCACAGGAGGAGGAGCTGGTGCG
CAGACATCTTCTCTCTTCAAAGCCCCAGCATCTGGAGCTGATGCCACCAAGCCAGTCTTCCCCTCTCTGGGCACT
CCGTCCTCGACCCCTCAAACCTCTACGACGCCAGCTGCCTCGTCCGCTGCGCCACAGACTTCCTCTCTTTTCCCA
GCCCTAGGTGGAGCGTCCTCGTCCGCGACTCCATCATCAACACCCGCTCCCTCTGGAGGCTTGTTTGGCGGTGCC
CTCGGTGGCGCTAAGTCCACAGCAACCACCGCTCCCGCCACTACAGCTACCGCAGCTCCCGCGACACAACCTGCG
GCAGCCACCGGCGGCCTGTTCGGTAAGCCCGCGGAGACCACCCCGTCCACACAGCCAGCCAGCACTGCTGCTGGA
GCCTCTGCTACGACGGCTGGCGACAAGCCCACCCTGACCGCTACCTCTGGCGCCACCTCTTCAGCTACCACCGGT
ACAGCAGGCGCAACAGGCACAACCACCGCCACTGGCGGAATTGGCCTTGGTGCCTCGACTGCTGGACCGACTCCT
CCGGCGCAGTCCCGCCTGAAGAACAAGACCATGGATGAGATCATCACCCGGTGGGCGACTGATCTGACCAAGTAC
CAGAAGGACTTCCGCGAGCAAGCCGAGAAGGTAGCAGAATGGGATCGGATGCTGGTTGAGAACGGCACCAAGGTG
CAGAAACTGTACGGCAGCACGGTGGATGCTGAGCGCGCGACTCAAGAAGTCGAGCGTCAGCTGGCGTCCGTCGAG
GGCCAGCAGGAAGAGCTCAGCTCCTGGCTCGACCGGTACGAGCGTGAAGTGGACGAGATGATTTCCAAGCAAGTC
GGACCGGGTGAAACTCTGCAGGGACCTGACCAGGAGCGTGAACGGACGTATGTTATTCCCATCCAACAATTATCC
TTTGATCTCTCGGTATGCTAACAGGATTACTAAAACAGATACAAAATGGCCGAGAAGCTCTCCGAGCGCCTGGAC
GAAATGGGCAAGGATCTGACAAGCATGATTGAGGAAGTCAACGGCGCGTCCTCGACTCTCAGCAAGACGAACAAG
GCTGACGAGCCGGTACGTATCCCCTTCTCCCCAAGATCCTTAAAGCTTATGCTAATGTATACCATGAATAGATCT
CGCAAATCGTCCGCATCCTCAACTCCCACCTCGCGCAACTGCAGGTCATCGACCAAGGCACCACGGAGCTCCAGG
CCAAGGTCGACGCCGCACAGAAGGCCGGCCAGTCCCTCTCTTCGCGGTTCGGGTATGGTCTGGGTAGCTCTAGTG
TGGGCGGTAGTGCCGCAGATGATTTCTATCGCTCTTACATGGGACGTCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail