Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9558.t1
Gene name
Locationscaffold_089:67794..77474
Strand+
Gene length (bp)9680
Transcript length (bp)9612
Coding sequence length (bp)9612
Protein length (aa) 3204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 5.1E-86 234 659
PF00668 Condensation Condensation domain 1.7E-84 1312 1742
PF00668 Condensation Condensation domain 6.0E-28 2803 3116
PF00501 AMP-binding AMP-binding enzyme 1.8E-73 691 1095
PF00501 AMP-binding AMP-binding enzyme 2.6E-59 1776 2147
PF00550 PP-binding Phosphopantetheine attachment site 1.6E-09 57 119
PF00550 PP-binding Phosphopantetheine attachment site 3.1E-10 1215 1276
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-09 2699 2761
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 1.1E-07 1104 1182

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9558.t1
MWPSIYLPLESVPLTTTAKTDRKKLRHIICASTRQDLEKDLTPTSPIVSPATELEMKLHQLFAEALRVEPTSFGV
NHSFIRLGGDSVTAMRLANRCSQMQYRLTMQDILQHQTVANLASQLDLYSKDNAPSSTPAIEHRAPERSFQPGSE
SGIQDEFVKVLEASISATDPLTDRGVESATATQLVDRINGQFGTKITGNEILPIIAALARRPESQVNEHVPIPNT
PSTEPVVQSFAQRRLWFLDQLHPDSTWYLLPLATRLRGHLNLSALEIALNAVVERHEPLRTTFNNQGGIEVQVVH
PFRPKPLEIIDMAPKKDQDIWDALQSEQRTTFNLEDEPGWRPLVFRLGPDDHILSIVMHHIISDGWSVDILRNEL
NIFYSAAIRSRAPLSQVDPLPTHYRDFSAWQRQHEDKSQSRVKVWLQELDGSKPAQLLCDKPRPAILSGDAGRQT
VDISGVLYQNLQRFCRAHRVTAHTVLLATFRAAQYRLTGTKDAVIGTPFAGRYHHELEPLIGFFVNLQCIRTEVE
HAHTTFYHLVQQIRAKMHMAFAHQDIPFERIVSELADERDPSRNPLVQLVFAVHSQTDLGTLSIEGVEAERLTLS
SASRFDLEFHFYEGGDCFQGEILYSLDLFHPETINLVQSTFVDILEHGISQPTTPIDLMPLRDAAATMRKNGLLH
TPNTDCPLESSVVDLFQRQSKCCPDKVAVKDSFMQLTYEELNSKSDIVAEFLNTQSLEPGSVIGVFAERSCEAII
AFLGILKASLAYLPLDVRSPVSRLEKILSSAKACKPVLVGSCIECPSLTSADHQFLRLSDLLNGSTRNELDFQHT
VRPRMPGPDDVAYIVYTSGSTGTPKGVIIQHKAIIRLTQCTNIISHDEAAGNIAHMSNLAFDMSVWEIYTALLNG
GTLICIDHMTVLDYRLLAQVLVRESIRVAMITPAMLKQCLIEVPSTISCLDILFVAGDRLDPSDAIKARTLVRNE
LINAYGPTENGVLSTIYRIRQDGVYPNGIPIGRSISNSGAYVVDPSYRLVPIGVIGELIAVGDGLAKGYVDSRLD
AGRFVTVNIPGQSPTRAYRTGDFVRYRPTDGQLEYFGRMDQQVKIGGFRIELEEIEYVLLQNCKVRDAVTVIQQR
EGQVPDIMSFVTVPLDPGQIEATQQDLQEWVEDRLPSYMIPRAIRVLERMPINSNGKVDRQKLAGMTDTHTSRQP
ITVTLPPPDDVERAVLEEFTAVLRLKMGITDNFFKAGGHSLLATRMASRIMKRLDVKITVRDIFDFPTAASLAKR
IRQCEPSKYVQISPVEHKGPVGKGEPGEPGEQRGAVMKLSFAQGRLWMLEQMNPGQSWYHVPFAVRLHGSLQLEA
LEKAFFTLAERHESLRTTFENQGALPIQVVHPHPSKPRPLKVIDATTSLNMDFMTILHHEQTTTFDLSTEPAWRV
AIIRLGPETHVLSVVIHHILCDGWSVGIIQKELAIFYASAVRGEVPSSCLAPLPIQYRDFAAWQHEVSQGHEHRR
QLDYWVTQLEGSHPAEFLCDKPRPASFAGAAGVRLIQVKDTTYTQLQQFCQTNQVTPFVVLLTTFRITHYRLTGS
TDATIGTPVANRNREELEDLVGFFVNLQCLRIPVEEMSFLELVQQVRSTTSAASANQDVPFEHIVSTMQTDRDLS
RNPLVQVVFVLHSEVNMAAFRLEGIETKPVDLVPTSRFDMEFHLYQRHNALEGYILYAESLFNAETIEIIQRTFD
KVLQHGLLLPSTTPDAFPLVDDYTSPDADTMKQVYGHCTDYPRDMNVIEAFQRQVASFPSRIAVTDQSARLTYSE
LDSRSDRVASWLSALSLPVEMPVAVLAHRSCEATVALLGILKATLAYLPLDVRAPAGRIETVLSLVPNCKLLLLG
SGLRNPVAKLEGITAKPITEASMEFNHLLSRPSATSLAYIMFTSGSTGQPKGVMVEHRGIIRLVKGSDVASEACS
VAHMSNLAFDASTWEIYIALLNGGTVVCIDPMTVADYSALGEVFQHESVRMAFFTPALLKQCLTVSPATVSMLDT
LVTGGDVLDPDDVVKHNVLHTTGDDACVNGVPIGQPIFNSGACVVDRDLRVVPVGTIGELIVTGDGLARGYTQPK
LDQGRFITLPVGPKTVRGYRTGDIVRYRPGDRQLEYFGRIDQQVKIRGHRVELTEIDQSLLAFSFIKEAVSICRK
EEARGPDLVSFVTADNGQDSHAIMGGVRQDTTGQVEDWKELFETNVYNPSDLRPGELGRDFTGWKSMYTGAPIER
KEMNEWLGDTISALLNGSSPGHVFEVGTGTGMMLFNLVKGLQSYVGLEPSTTALDFVQAAVPNIPGLKGKVRLLT
GTADDMNRLDRFNPVDVAVINSVAQYFPTPDYLLKVVEDLMCLQGAKRIFLGDIRSYALYEEFQVSRALYSRTQG
LPTVADIRSQMAETVHMEEELLVDPAFFTSLPSRFPHLVEHVEILPKRMVATNELSCYRYAAVLYAKQQPNLGLR
IHDVEESQWVDFSARKMNRESLLQNLQQRVPDSSVVAISNIPYSKINLERLIVDQLKDRLVDRVGGPGWLAPLRE
TAKKFPSLAAIDLIDLAEKTGFQVEISWARQHSQRGGLDAVFHRIEPAQKGARVLFRFPTDHQGRAPGQLSNNPL
QLSSNRDMEKWVRKALQKSLPPYMVPRLVRVLERMPINSNGKIDRKALASMVAGTVSQNTVSARVDPRDDLERAL
LHQFTKALGQDIGVLESLFDHGGHSLTAIKLVNGINEQLHTRARASDIFECPTVAGLAARIRSWPGSITRPVAST
FSLVGGNLSPATSGELAKIGLSPTEVADIVPVTNTQAWFLTRWAPVSMRLNLHGRIDINQWRTACHAVAQKHSTL
RTLFTRLEGRFVQVILRAVNVPFTHKLTSDTVSDEAHSGLSPVSTKLYTRFELVSQSPTSHSFIVRLSHAQYDGF
SLPLLFSDLVAAYNGNLLSPPVAVPFSDYVYGCAYHQSPDSLSFWNDYLRGARLTTLSDPTLSADDKSIDVKAIV
TGELPPSLPGITFPTLANAAFAFTLAEMVCSQDVTFGLVLNLRDLPINGVEAILGPCINISPVRVQSQQAWTVSD
LCHNLHDSYTAVSRHGYVELPDIVANCTDWPRDSDFGCLINHFPPNRTPSFSLKDAEVVDFSMDSRIDLTDQLLV
RSIVGEGTWEVQVLTSSNVMSDEKASALAERLLKTGQKFSQYPETPLSSHLLR*
Coding >Ani_SJS100_1|g9558.t1
ATGTGGCCGAGCATTTACCTCCCCCTCGAATCTGTTCCGTTGACCACCACTGCCAAAACCGATCGAAAGAAGCTC
CGTCACATTATTTGCGCTTCTACTCGCCAGGATCTGGAGAAAGATCTGACACCGACATCTCCTATCGTGTCACCA
GCGACCGAGCTGGAGATGAAACTTCATCAACTATTTGCTGAAGCTCTGCGTGTCGAGCCAACCTCCTTTGGCGTC
AATCATAGCTTTATCCGTCTTGGCGGCGACTCGGTGACAGCCATGCGTTTAGCCAATCGTTGTAGTCAAATGCAG
TACAGATTGACGATGCAAGATATTCTTCAACACCAAACGGTGGCCAACCTTGCCTCGCAGCTTGATCTGTACAGC
AAGGATAACGCGCCATCCTCTACACCTGCCATTGAACACCGGGCCCCTGAACGGTCTTTCCAACCAGGGAGCGAA
TCTGGCATCCAGGACGAATTTGTCAAAGTGCTGGAAGCCAGCATCAGTGCTACTGATCCTTTAACTGATCGTGGC
GTTGAGTCCGCGACGGCCACACAGTTAGTTGACCGAATCAATGGACAATTCGGCACTAAGATCACTGGCAACGAG
ATTCTCCCAATAATAGCTGCTCTCGCGAGACGGCCTGAGTCCCAGGTGAATGAGCATGTGCCTATACCCAACACA
CCATCTACCGAGCCAGTAGTGCAGTCATTTGCACAGCGCCGCCTATGGTTTCTAGACCAATTGCATCCCGATTCA
ACATGGTATCTCCTGCCCCTTGCCACACGACTGCGCGGTCATCTCAACCTTTCTGCGTTGGAGATAGCCCTCAAT
GCAGTAGTAGAACGCCATGAGCCTCTCCGCACCACGTTTAACAATCAAGGTGGCATTGAAGTGCAAGTAGTCCAT
CCTTTTAGGCCAAAGCCGCTTGAGATAATTGATATGGCGCCCAAGAAAGACCAGGACATTTGGGATGCCTTGCAG
AGCGAACAACGCACCACGTTCAATTTGGAGGACGAACCAGGGTGGAGGCCATTGGTGTTCCGTCTGGGGCCTGAT
GATCATATCTTGTCAATTGTCATGCACCATATTATTTCCGATGGATGGTCGGTCGATATCCTTCGAAACGAACTC
AATATCTTCTACTCCGCAGCAATTCGCTCACGTGCCCCCCTATCACAAGTTGATCCGCTCCCAACGCATTACCGT
GACTTCTCGGCTTGGCAACGGCAGCATGAAGATAAGAGCCAGTCGCGAGTAAAGGTTTGGCTTCAGGAACTTGAT
GGAAGCAAGCCGGCTCAACTCCTCTGTGACAAGCCGCGTCCTGCTATACTCTCCGGTGATGCGGGTCGTCAGACG
GTTGATATCAGTGGTGTGCTCTACCAGAACCTGCAGCGATTTTGCAGGGCCCACCGGGTCACCGCTCATACGGTC
TTGCTTGCTACATTCAGGGCAGCACAATATCGCCTCACAGGTACTAAAGACGCAGTGATCGGCACACCATTTGCA
GGTCGCTATCACCACGAGCTAGAACCACTCATCGGATTCTTCGTCAATCTGCAGTGTATTCGGACGGAGGTCGAG
CATGCGCATACGACGTTTTATCACCTCGTTCAGCAGATTAGAGCGAAAATGCACATGGCGTTCGCTCACCAGGAT
ATCCCTTTCGAGAGGATTGTGTCGGAGCTAGCTGACGAGCGCGACCCCTCCCGTAACCCCCTTGTGCAATTGGTT
TTCGCTGTCCACTCCCAAACAGACTTGGGAACCTTGAGTATCGAAGGTGTGGAGGCTGAACGGCTTACACTGTCT
TCAGCCTCCAGGTTTGACCTCGAATTTCACTTCTACGAGGGTGGAGATTGTTTTCAAGGGGAAATTTTGTATTCT
CTAGACCTGTTTCATCCGGAGACAATCAACTTAGTCCAGTCCACCTTTGTTGATATTCTTGAACACGGAATAAGT
CAGCCTACTACACCTATCGATTTGATGCCTCTCAGAGATGCCGCCGCCACCATGCGAAAGAATGGCCTACTCCAC
ACCCCCAACACCGACTGCCCTCTCGAATCGAGTGTAGTCGATCTGTTTCAACGACAAAGCAAGTGTTGTCCCGAC
AAAGTGGCTGTCAAAGACTCTTTTATGCAGCTTACCTACGAGGAACTAAACTCCAAATCTGATATAGTCGCTGAG
TTTCTAAATACCCAGTCCCTGGAGCCAGGAAGTGTCATTGGTGTCTTTGCAGAACGAAGCTGCGAAGCGATAATT
GCATTCCTGGGCATTCTAAAGGCGAGTCTTGCCTATCTACCGCTCGATGTCAGATCCCCGGTCAGCCGCCTGGAA
AAAATCTTGTCATCTGCCAAAGCGTGCAAGCCTGTTCTTGTTGGTAGTTGTATCGAGTGTCCTAGTCTCACTTCG
GCTGATCATCAGTTTCTTCGTCTTTCAGACCTTCTCAATGGGTCGACTCGAAATGAACTTGACTTTCAGCACACG
GTGAGGCCTAGGATGCCCGGCCCCGACGACGTCGCATATATTGTGTATACATCTGGTTCCACAGGAACGCCCAAG
GGAGTCATAATTCAACACAAGGCGATCATCAGGTTGACACAGTGCACCAACATTATCAGTCATGATGAGGCTGCT
GGGAATATAGCACATATGAGTAATCTTGCTTTTGATATGTCAGTTTGGGAGATATACACAGCACTTCTCAATGGA
GGAACATTGATCTGCATCGACCATATGACTGTATTAGACTACAGGTTGCTCGCTCAGGTCTTGGTGCGGGAGAGT
ATCCGAGTTGCCATGATAACTCCAGCTATGCTAAAGCAGTGCCTTATCGAAGTCCCATCGACCATCAGTTGCTTA
GATATTCTGTTTGTCGCAGGAGACCGTCTGGATCCATCTGACGCCATCAAAGCCCGAACACTGGTCCGAAACGAG
CTGATAAATGCCTATGGGCCAACTGAGAATGGGGTATTGAGCACCATTTACAGGATCCGACAGGATGGGGTCTAT
CCGAATGGCATCCCTATTGGTAGATCTATCAGTAACTCTGGTGCGTACGTGGTAGATCCAAGCTACCGGTTAGTC
CCAATTGGAGTCATCGGTGAGCTTATCGCCGTGGGAGACGGACTGGCCAAAGGGTACGTTGACTCACGGCTCGAT
GCTGGCCGGTTCGTGACGGTCAATATTCCTGGGCAATCACCGACACGAGCATACCGGACCGGAGACTTTGTGCGA
TACCGGCCGACTGATGGCCAGCTTGAATACTTTGGCCGCATGGATCAGCAGGTCAAGATTGGAGGTTTCCGTATC
GAACTTGAGGAGATTGAATATGTGCTCCTTCAGAACTGCAAAGTGAGAGATGCGGTAACGGTCATCCAGCAAAGA
GAAGGCCAGGTTCCGGACATTATGAGCTTTGTCACCGTCCCATTGGATCCAGGCCAGATTGAGGCCACGCAACAG
GATCTCCAGGAGTGGGTTGAAGATAGATTACCGTCTTACATGATTCCTCGCGCCATTCGAGTGCTGGAACGGATG
CCAATCAATAGTAATGGGAAGGTTGACCGTCAGAAGCTGGCAGGAATGACGGATACTCATACTTCTCGCCAGCCT
ATAACAGTCACATTACCACCGCCAGATGATGTGGAACGCGCGGTGCTGGAAGAATTTACAGCAGTGCTCAGGTTG
AAGATGGGAATCACAGACAACTTTTTCAAGGCTGGTGGCCACTCACTACTGGCCACCAGAATGGCCTCTAGGATC
ATGAAACGGCTGGATGTCAAAATCACGGTGAGGGATATATTTGACTTTCCTACTGCTGCCAGCCTTGCAAAGAGG
ATTCGGCAATGTGAACCGAGCAAGTATGTTCAGATATCGCCCGTCGAGCACAAGGGACCCGTAGGGAAAGGGGAA
CCAGGGGAACCCGGGGAACAGAGGGGAGCGGTCATGAAGTTGTCCTTTGCGCAAGGCCGCCTTTGGATGCTGGAG
CAAATGAATCCTGGCCAATCCTGGTACCATGTTCCATTTGCGGTGCGGCTGCACGGCTCTCTACAGCTTGAAGCC
TTAGAGAAGGCTTTTTTCACCCTTGCGGAGCGTCATGAAAGTCTTCGAACGACGTTTGAAAACCAGGGGGCACTT
CCAATACAAGTTGTCCATCCCCATCCGTCCAAGCCTCGGCCCTTGAAGGTTATTGATGCAACCACCAGCCTGAAT
ATGGACTTCATGACTATCCTTCACCACGAACAGACGACTACATTCGACCTCTCTACAGAGCCAGCATGGCGAGTG
GCGATTATTCGCTTGGGACCAGAGACCCACGTGCTTTCCGTGGTCATACACCATATCCTTTGCGATGGTTGGTCA
GTTGGCATCATTCAGAAGGAACTAGCTATATTTTATGCTTCGGCTGTTCGGGGCGAGGTGCCCTCGTCATGTCTT
GCTCCGCTTCCGATCCAGTACCGCGACTTTGCGGCCTGGCAACATGAGGTCAGTCAGGGTCATGAGCATCGACGA
CAGCTGGATTATTGGGTAACCCAGCTGGAGGGGAGCCATCCTGCCGAGTTTCTTTGCGACAAACCACGACCAGCG
TCCTTCGCGGGAGCTGCTGGTGTTCGCCTAATCCAAGTTAAAGACACGACATATACGCAATTGCAGCAGTTCTGC
CAGACAAATCAGGTTACCCCCTTTGTTGTCTTGTTAACGACATTTCGCATCACGCACTACAGGCTGACAGGATCA
ACGGATGCAACAATTGGTACACCTGTTGCCAATCGAAATCGTGAAGAACTCGAAGACCTGGTTGGGTTTTTCGTT
AACCTCCAATGTCTTCGAATTCCAGTCGAGGAGATGTCGTTTCTTGAGCTAGTCCAACAAGTCCGTTCAACTACG
TCTGCAGCATCTGCCAATCAAGATGTGCCGTTCGAGCACATTGTAAGTACTATGCAAACTGACCGTGATCTTTCC
CGGAATCCCTTAGTTCAGGTAGTTTTTGTTCTTCACTCTGAAGTAAACATGGCTGCATTCCGTCTCGAGGGGATT
GAAACTAAGCCGGTCGATCTCGTACCGACTTCGCGGTTTGATATGGAGTTCCACCTGTACCAAAGACACAATGCG
CTTGAAGGCTACATCCTCTACGCCGAATCGTTATTCAACGCAGAAACGATTGAGATTATACAGCGAACATTTGAT
AAGGTCCTCCAGCACGGTCTCCTGCTACCCTCTACCACGCCTGACGCATTTCCGCTGGTGGACGACTACACCAGC
CCGGACGCAGATACTATGAAACAGGTCTACGGTCATTGCACAGACTATCCACGAGATATGAACGTCATTGAAGCT
TTTCAGCGGCAGGTGGCGAGTTTCCCAAGTCGCATAGCAGTCACAGATCAGTCAGCGCGACTGACGTATTCCGAG
CTGGATAGCCGGTCAGACCGGGTTGCATCCTGGCTGTCGGCGCTCTCGCTTCCCGTGGAAATGCCGGTGGCGGTG
CTCGCACATCGATCATGTGAAGCTACTGTTGCTCTTCTTGGGATCCTCAAAGCAACCTTGGCATATCTTCCACTA
GATGTTCGAGCCCCCGCAGGCCGCATCGAAACTGTTCTCTCACTCGTACCCAACTGCAAACTGCTTCTGCTAGGA
TCTGGTCTTCGGAATCCTGTAGCCAAACTGGAAGGGATCACAGCAAAGCCGATCACCGAGGCTAGCATGGAATTT
AACCACCTTCTTTCCCGACCGTCGGCCACCAGCCTTGCGTACATCATGTTTACTTCCGGATCGACGGGACAGCCA
AAGGGTGTCATGGTGGAACATCGTGGGATTATCCGATTGGTGAAGGGTAGCGACGTGGCGAGCGAGGCCTGCTCT
GTCGCTCACATGTCGAATCTGGCCTTCGATGCCTCCACATGGGAAATATATATTGCGCTGCTGAATGGCGGCACC
GTGGTGTGCATCGATCCGATGACAGTGGCAGATTATTCTGCGCTTGGTGAAGTGTTTCAGCATGAGAGTGTCCGC
ATGGCATTCTTTACACCGGCACTACTCAAGCAATGCCTAACTGTGTCTCCTGCGACGGTGAGTATGCTAGACACC
CTGGTCACAGGAGGCGACGTACTTGATCCAGACGATGTGGTCAAGCACAATGTATTGCATACCACCGGGGATGAT
GCATGTGTTAACGGGGTTCCAATTGGTCAACCAATCTTCAACTCTGGAGCCTGTGTAGTGGATCGCGACCTCCGG
GTTGTGCCTGTTGGTACAATTGGCGAGCTCATTGTTACGGGAGACGGTCTGGCCCGAGGCTATACACAGCCAAAA
TTGGACCAGGGGAGATTTATAACTCTGCCGGTCGGCCCGAAAACAGTGCGAGGGTATCGCACCGGCGATATTGTT
CGATATCGGCCTGGTGACCGCCAGTTGGAGTACTTTGGGCGCATCGATCAACAGGTGAAAATCCGTGGCCATCGG
GTGGAACTTACTGAGATCGACCAATCTTTGCTCGCTTTCAGCTTCATCAAGGAGGCTGTATCAATCTGCCGTAAA
GAGGAAGCCCGGGGACCTGATTTGGTTAGCTTCGTTACAGCCGATAACGGTCAGGATTCGCACGCAATCATGGGA
GGAGTCAGGCAGGACACGACTGGGCAAGTCGAAGACTGGAAAGAACTGTTCGAAACAAATGTTTATAATCCCTCT
GATTTACGTCCTGGCGAGCTTGGGAGAGACTTCACTGGTTGGAAGTCAATGTATACTGGCGCACCGATTGAGAGA
AAAGAGATGAACGAATGGCTAGGCGACACCATTAGCGCACTCCTTAATGGAAGCTCGCCCGGTCATGTGTTTGAA
GTCGGAACTGGCACTGGCATGATGCTGTTTAATCTCGTCAAAGGGCTGCAGAGCTACGTCGGGCTTGAGCCCTCG
ACTACGGCACTTGACTTTGTCCAGGCAGCTGTTCCCAATATTCCCGGATTAAAAGGGAAGGTGCGGTTGCTGACA
GGGACAGCAGACGATATGAATCGACTTGACAGATTCAACCCTGTGGATGTCGCCGTCATCAACTCGGTAGCGCAG
TACTTCCCAACTCCTGACTATCTGCTCAAGGTTGTTGAGGATCTAATGTGTCTGCAAGGTGCCAAGCGAATTTTC
CTTGGTGATATACGGTCATATGCACTCTACGAGGAATTTCAAGTGAGCCGGGCACTATACAGTCGTACCCAGGGA
CTACCCACTGTGGCCGATATTCGATCACAGATGGCGGAAACGGTTCACATGGAAGAGGAGCTACTGGTAGACCCG
GCCTTTTTCACTTCCCTACCAAGCCGTTTTCCGCATCTTGTCGAGCATGTGGAAATTCTGCCCAAGCGTATGGTA
GCAACCAACGAGCTCAGCTGTTACCGCTATGCCGCTGTTCTGTACGCCAAGCAGCAGCCGAACTTGGGGCTGCGC
ATCCACGACGTTGAAGAGAGCCAATGGGTTGATTTTTCCGCAAGGAAGATGAATCGCGAGTCTCTGTTGCAAAAT
TTGCAGCAACGGGTCCCCGATTCATCAGTGGTGGCAATCAGCAATATCCCCTACAGCAAGATTAACCTGGAACGG
CTTATAGTAGACCAGTTGAAGGACCGCTTGGTTGATAGGGTTGGAGGACCTGGCTGGCTCGCGCCACTCCGTGAA
ACCGCCAAGAAGTTCCCATCTCTTGCAGCCATTGATTTGATAGACCTGGCGGAGAAGACGGGTTTTCAAGTCGAG
ATCAGCTGGGCTCGCCAGCACTCACAACGTGGTGGGCTGGACGCCGTCTTCCACCGCATTGAGCCTGCCCAGAAG
GGCGCAAGGGTGCTATTTCGGTTCCCAACAGACCACCAGGGACGAGCACCTGGTCAATTGAGTAACAACCCACTA
CAACTGTCATCCAATCGAGACATGGAGAAGTGGGTGCGGAAGGCCTTGCAAAAGTCATTGCCACCGTATATGGTC
CCCAGACTGGTCAGGGTTTTGGAGCGAATGCCTATCAACAGCAATGGGAAGATCGACCGCAAGGCTCTGGCAAGC
ATGGTTGCTGGCACTGTATCCCAAAACACTGTGTCAGCTAGAGTCGATCCGCGTGATGATCTGGAACGAGCGTTG
CTTCATCAGTTTACGAAGGCGCTCGGGCAAGATATCGGCGTTCTCGAAAGCTTGTTTGATCATGGGGGCCACTCG
CTGACTGCGATAAAGCTGGTCAATGGGATCAATGAACAGCTCCATACTCGTGCCAGGGCGAGTGACATCTTCGAG
TGTCCTACTGTTGCCGGTCTCGCCGCAAGGATTCGATCCTGGCCGGGATCGATAACGAGACCTGTCGCCTCAACG
TTTTCCCTTGTTGGGGGCAATCTCTCACCTGCCACTTCAGGCGAGCTCGCCAAAATTGGACTGAGTCCCACTGAA
GTTGCTGATATCGTTCCTGTGACAAACACACAGGCCTGGTTCCTTACCCGATGGGCCCCAGTCTCCATGCGCCTT
AATCTCCACGGCAGGATCGATATCAATCAGTGGAGAACGGCTTGTCACGCTGTGGCACAAAAGCACAGTACTCTA
CGCACTTTGTTTACTAGACTCGAAGGGAGATTCGTCCAGGTCATCCTGCGAGCAGTCAACGTTCCATTTACCCAC
AAGTTGACCAGTGATACGGTTTCCGATGAGGCTCATTCTGGGCTTTCTCCGGTCTCCACGAAGCTATATACGAGA
TTTGAACTAGTTTCTCAGTCTCCGACAAGTCACTCGTTCATTGTTCGGTTGTCTCATGCACAATACGACGGGTTT
TCACTCCCGCTCCTCTTTTCCGATTTGGTTGCAGCTTACAATGGTAACCTGCTCTCGCCACCAGTAGCAGTCCCC
TTCTCGGACTACGTATATGGATGTGCATACCACCAATCACCAGATTCGCTGAGCTTCTGGAATGACTATTTGCGG
GGGGCTCGTCTGACCACCTTATCCGATCCAACCCTTTCTGCAGATGACAAGTCTATAGATGTCAAAGCGATCGTG
ACTGGTGAACTTCCCCCATCGTTGCCTGGCATCACGTTCCCCACTCTTGCCAATGCAGCATTCGCTTTCACGCTG
GCGGAGATGGTGTGCAGCCAAGATGTCACATTCGGGCTGGTTCTGAACCTTCGTGACCTACCCATCAACGGCGTG
GAAGCCATCCTTGGACCGTGTATCAACATCAGTCCCGTGCGAGTGCAATCGCAGCAGGCTTGGACAGTCAGCGAT
CTCTGCCACAACTTACATGACAGTTACACCGCGGTTTCTCGTCACGGATACGTCGAATTGCCGGATATTGTTGCC
AACTGCACCGACTGGCCAAGGGACAGTGACTTTGGCTGCCTGATAAATCATTTCCCTCCGAATCGTACCCCTTCG
TTCTCATTGAAAGACGCAGAAGTGGTGGACTTTTCAATGGATTCTCGAATCGATCTGACAGATCAGCTGCTTGTT
CGCTCGATCGTGGGTGAGGGAACTTGGGAAGTACAGGTGCTGACTTCAAGCAACGTGATGAGCGACGAAAAGGCC
TCCGCATTGGCTGAGAGGCTTTTGAAAACGGGGCAGAAATTCTCGCAGTACCCAGAAACACCCTTATCTTCCCAT
CTATTGCGTTAA
Transcript >Ani_SJS100_1|g9558.t1
ATGTGGCCGAGCATTTACCTCCCCCTCGAATCTGTTCCGTTGACCACCACTGCCAAAACCGATCGAAAGAAGCTC
CGTCACATTATTTGCGCTTCTACTCGCCAGGATCTGGAGAAAGATCTGACACCGACATCTCCTATCGTGTCACCA
GCGACCGAGCTGGAGATGAAACTTCATCAACTATTTGCTGAAGCTCTGCGTGTCGAGCCAACCTCCTTTGGCGTC
AATCATAGCTTTATCCGTCTTGGCGGCGACTCGGTGACAGCCATGCGTTTAGCCAATCGTTGTAGTCAAATGCAG
TACAGATTGACGATGCAAGATATTCTTCAACACCAAACGGTGGCCAACCTTGCCTCGCAGCTTGATCTGTACAGC
AAGGATAACGCGCCATCCTCTACACCTGCCATTGAACACCGGGCCCCTGAACGGTCTTTCCAACCAGGGAGCGAA
TCTGGCATCCAGGACGAATTTGTCAAAGTGCTGGAAGCCAGCATCAGTGCTACTGATCCTTTAACTGATCGTGGC
GTTGAGTCCGCGACGGCCACACAGTTAGTTGACCGAATCAATGGACAATTCGGCACTAAGATCACTGGCAACGAG
ATTCTCCCAATAATAGCTGCTCTCGCGAGACGGCCTGAGTCCCAGGTGAATGAGCATGTGCCTATACCCAACACA
CCATCTACCGAGCCAGTAGTGCAGTCATTTGCACAGCGCCGCCTATGGTTTCTAGACCAATTGCATCCCGATTCA
ACATGGTATCTCCTGCCCCTTGCCACACGACTGCGCGGTCATCTCAACCTTTCTGCGTTGGAGATAGCCCTCAAT
GCAGTAGTAGAACGCCATGAGCCTCTCCGCACCACGTTTAACAATCAAGGTGGCATTGAAGTGCAAGTAGTCCAT
CCTTTTAGGCCAAAGCCGCTTGAGATAATTGATATGGCGCCCAAGAAAGACCAGGACATTTGGGATGCCTTGCAG
AGCGAACAACGCACCACGTTCAATTTGGAGGACGAACCAGGGTGGAGGCCATTGGTGTTCCGTCTGGGGCCTGAT
GATCATATCTTGTCAATTGTCATGCACCATATTATTTCCGATGGATGGTCGGTCGATATCCTTCGAAACGAACTC
AATATCTTCTACTCCGCAGCAATTCGCTCACGTGCCCCCCTATCACAAGTTGATCCGCTCCCAACGCATTACCGT
GACTTCTCGGCTTGGCAACGGCAGCATGAAGATAAGAGCCAGTCGCGAGTAAAGGTTTGGCTTCAGGAACTTGAT
GGAAGCAAGCCGGCTCAACTCCTCTGTGACAAGCCGCGTCCTGCTATACTCTCCGGTGATGCGGGTCGTCAGACG
GTTGATATCAGTGGTGTGCTCTACCAGAACCTGCAGCGATTTTGCAGGGCCCACCGGGTCACCGCTCATACGGTC
TTGCTTGCTACATTCAGGGCAGCACAATATCGCCTCACAGGTACTAAAGACGCAGTGATCGGCACACCATTTGCA
GGTCGCTATCACCACGAGCTAGAACCACTCATCGGATTCTTCGTCAATCTGCAGTGTATTCGGACGGAGGTCGAG
CATGCGCATACGACGTTTTATCACCTCGTTCAGCAGATTAGAGCGAAAATGCACATGGCGTTCGCTCACCAGGAT
ATCCCTTTCGAGAGGATTGTGTCGGAGCTAGCTGACGAGCGCGACCCCTCCCGTAACCCCCTTGTGCAATTGGTT
TTCGCTGTCCACTCCCAAACAGACTTGGGAACCTTGAGTATCGAAGGTGTGGAGGCTGAACGGCTTACACTGTCT
TCAGCCTCCAGGTTTGACCTCGAATTTCACTTCTACGAGGGTGGAGATTGTTTTCAAGGGGAAATTTTGTATTCT
CTAGACCTGTTTCATCCGGAGACAATCAACTTAGTCCAGTCCACCTTTGTTGATATTCTTGAACACGGAATAAGT
CAGCCTACTACACCTATCGATTTGATGCCTCTCAGAGATGCCGCCGCCACCATGCGAAAGAATGGCCTACTCCAC
ACCCCCAACACCGACTGCCCTCTCGAATCGAGTGTAGTCGATCTGTTTCAACGACAAAGCAAGTGTTGTCCCGAC
AAAGTGGCTGTCAAAGACTCTTTTATGCAGCTTACCTACGAGGAACTAAACTCCAAATCTGATATAGTCGCTGAG
TTTCTAAATACCCAGTCCCTGGAGCCAGGAAGTGTCATTGGTGTCTTTGCAGAACGAAGCTGCGAAGCGATAATT
GCATTCCTGGGCATTCTAAAGGCGAGTCTTGCCTATCTACCGCTCGATGTCAGATCCCCGGTCAGCCGCCTGGAA
AAAATCTTGTCATCTGCCAAAGCGTGCAAGCCTGTTCTTGTTGGTAGTTGTATCGAGTGTCCTAGTCTCACTTCG
GCTGATCATCAGTTTCTTCGTCTTTCAGACCTTCTCAATGGGTCGACTCGAAATGAACTTGACTTTCAGCACACG
GTGAGGCCTAGGATGCCCGGCCCCGACGACGTCGCATATATTGTGTATACATCTGGTTCCACAGGAACGCCCAAG
GGAGTCATAATTCAACACAAGGCGATCATCAGGTTGACACAGTGCACCAACATTATCAGTCATGATGAGGCTGCT
GGGAATATAGCACATATGAGTAATCTTGCTTTTGATATGTCAGTTTGGGAGATATACACAGCACTTCTCAATGGA
GGAACATTGATCTGCATCGACCATATGACTGTATTAGACTACAGGTTGCTCGCTCAGGTCTTGGTGCGGGAGAGT
ATCCGAGTTGCCATGATAACTCCAGCTATGCTAAAGCAGTGCCTTATCGAAGTCCCATCGACCATCAGTTGCTTA
GATATTCTGTTTGTCGCAGGAGACCGTCTGGATCCATCTGACGCCATCAAAGCCCGAACACTGGTCCGAAACGAG
CTGATAAATGCCTATGGGCCAACTGAGAATGGGGTATTGAGCACCATTTACAGGATCCGACAGGATGGGGTCTAT
CCGAATGGCATCCCTATTGGTAGATCTATCAGTAACTCTGGTGCGTACGTGGTAGATCCAAGCTACCGGTTAGTC
CCAATTGGAGTCATCGGTGAGCTTATCGCCGTGGGAGACGGACTGGCCAAAGGGTACGTTGACTCACGGCTCGAT
GCTGGCCGGTTCGTGACGGTCAATATTCCTGGGCAATCACCGACACGAGCATACCGGACCGGAGACTTTGTGCGA
TACCGGCCGACTGATGGCCAGCTTGAATACTTTGGCCGCATGGATCAGCAGGTCAAGATTGGAGGTTTCCGTATC
GAACTTGAGGAGATTGAATATGTGCTCCTTCAGAACTGCAAAGTGAGAGATGCGGTAACGGTCATCCAGCAAAGA
GAAGGCCAGGTTCCGGACATTATGAGCTTTGTCACCGTCCCATTGGATCCAGGCCAGATTGAGGCCACGCAACAG
GATCTCCAGGAGTGGGTTGAAGATAGATTACCGTCTTACATGATTCCTCGCGCCATTCGAGTGCTGGAACGGATG
CCAATCAATAGTAATGGGAAGGTTGACCGTCAGAAGCTGGCAGGAATGACGGATACTCATACTTCTCGCCAGCCT
ATAACAGTCACATTACCACCGCCAGATGATGTGGAACGCGCGGTGCTGGAAGAATTTACAGCAGTGCTCAGGTTG
AAGATGGGAATCACAGACAACTTTTTCAAGGCTGGTGGCCACTCACTACTGGCCACCAGAATGGCCTCTAGGATC
ATGAAACGGCTGGATGTCAAAATCACGGTGAGGGATATATTTGACTTTCCTACTGCTGCCAGCCTTGCAAAGAGG
ATTCGGCAATGTGAACCGAGCAAGTATGTTCAGATATCGCCCGTCGAGCACAAGGGACCCGTAGGGAAAGGGGAA
CCAGGGGAACCCGGGGAACAGAGGGGAGCGGTCATGAAGTTGTCCTTTGCGCAAGGCCGCCTTTGGATGCTGGAG
CAAATGAATCCTGGCCAATCCTGGTACCATGTTCCATTTGCGGTGCGGCTGCACGGCTCTCTACAGCTTGAAGCC
TTAGAGAAGGCTTTTTTCACCCTTGCGGAGCGTCATGAAAGTCTTCGAACGACGTTTGAAAACCAGGGGGCACTT
CCAATACAAGTTGTCCATCCCCATCCGTCCAAGCCTCGGCCCTTGAAGGTTATTGATGCAACCACCAGCCTGAAT
ATGGACTTCATGACTATCCTTCACCACGAACAGACGACTACATTCGACCTCTCTACAGAGCCAGCATGGCGAGTG
GCGATTATTCGCTTGGGACCAGAGACCCACGTGCTTTCCGTGGTCATACACCATATCCTTTGCGATGGTTGGTCA
GTTGGCATCATTCAGAAGGAACTAGCTATATTTTATGCTTCGGCTGTTCGGGGCGAGGTGCCCTCGTCATGTCTT
GCTCCGCTTCCGATCCAGTACCGCGACTTTGCGGCCTGGCAACATGAGGTCAGTCAGGGTCATGAGCATCGACGA
CAGCTGGATTATTGGGTAACCCAGCTGGAGGGGAGCCATCCTGCCGAGTTTCTTTGCGACAAACCACGACCAGCG
TCCTTCGCGGGAGCTGCTGGTGTTCGCCTAATCCAAGTTAAAGACACGACATATACGCAATTGCAGCAGTTCTGC
CAGACAAATCAGGTTACCCCCTTTGTTGTCTTGTTAACGACATTTCGCATCACGCACTACAGGCTGACAGGATCA
ACGGATGCAACAATTGGTACACCTGTTGCCAATCGAAATCGTGAAGAACTCGAAGACCTGGTTGGGTTTTTCGTT
AACCTCCAATGTCTTCGAATTCCAGTCGAGGAGATGTCGTTTCTTGAGCTAGTCCAACAAGTCCGTTCAACTACG
TCTGCAGCATCTGCCAATCAAGATGTGCCGTTCGAGCACATTGTAAGTACTATGCAAACTGACCGTGATCTTTCC
CGGAATCCCTTAGTTCAGGTAGTTTTTGTTCTTCACTCTGAAGTAAACATGGCTGCATTCCGTCTCGAGGGGATT
GAAACTAAGCCGGTCGATCTCGTACCGACTTCGCGGTTTGATATGGAGTTCCACCTGTACCAAAGACACAATGCG
CTTGAAGGCTACATCCTCTACGCCGAATCGTTATTCAACGCAGAAACGATTGAGATTATACAGCGAACATTTGAT
AAGGTCCTCCAGCACGGTCTCCTGCTACCCTCTACCACGCCTGACGCATTTCCGCTGGTGGACGACTACACCAGC
CCGGACGCAGATACTATGAAACAGGTCTACGGTCATTGCACAGACTATCCACGAGATATGAACGTCATTGAAGCT
TTTCAGCGGCAGGTGGCGAGTTTCCCAAGTCGCATAGCAGTCACAGATCAGTCAGCGCGACTGACGTATTCCGAG
CTGGATAGCCGGTCAGACCGGGTTGCATCCTGGCTGTCGGCGCTCTCGCTTCCCGTGGAAATGCCGGTGGCGGTG
CTCGCACATCGATCATGTGAAGCTACTGTTGCTCTTCTTGGGATCCTCAAAGCAACCTTGGCATATCTTCCACTA
GATGTTCGAGCCCCCGCAGGCCGCATCGAAACTGTTCTCTCACTCGTACCCAACTGCAAACTGCTTCTGCTAGGA
TCTGGTCTTCGGAATCCTGTAGCCAAACTGGAAGGGATCACAGCAAAGCCGATCACCGAGGCTAGCATGGAATTT
AACCACCTTCTTTCCCGACCGTCGGCCACCAGCCTTGCGTACATCATGTTTACTTCCGGATCGACGGGACAGCCA
AAGGGTGTCATGGTGGAACATCGTGGGATTATCCGATTGGTGAAGGGTAGCGACGTGGCGAGCGAGGCCTGCTCT
GTCGCTCACATGTCGAATCTGGCCTTCGATGCCTCCACATGGGAAATATATATTGCGCTGCTGAATGGCGGCACC
GTGGTGTGCATCGATCCGATGACAGTGGCAGATTATTCTGCGCTTGGTGAAGTGTTTCAGCATGAGAGTGTCCGC
ATGGCATTCTTTACACCGGCACTACTCAAGCAATGCCTAACTGTGTCTCCTGCGACGGTGAGTATGCTAGACACC
CTGGTCACAGGAGGCGACGTACTTGATCCAGACGATGTGGTCAAGCACAATGTATTGCATACCACCGGGGATGAT
GCATGTGTTAACGGGGTTCCAATTGGTCAACCAATCTTCAACTCTGGAGCCTGTGTAGTGGATCGCGACCTCCGG
GTTGTGCCTGTTGGTACAATTGGCGAGCTCATTGTTACGGGAGACGGTCTGGCCCGAGGCTATACACAGCCAAAA
TTGGACCAGGGGAGATTTATAACTCTGCCGGTCGGCCCGAAAACAGTGCGAGGGTATCGCACCGGCGATATTGTT
CGATATCGGCCTGGTGACCGCCAGTTGGAGTACTTTGGGCGCATCGATCAACAGGTGAAAATCCGTGGCCATCGG
GTGGAACTTACTGAGATCGACCAATCTTTGCTCGCTTTCAGCTTCATCAAGGAGGCTGTATCAATCTGCCGTAAA
GAGGAAGCCCGGGGACCTGATTTGGTTAGCTTCGTTACAGCCGATAACGGTCAGGATTCGCACGCAATCATGGGA
GGAGTCAGGCAGGACACGACTGGGCAAGTCGAAGACTGGAAAGAACTGTTCGAAACAAATGTTTATAATCCCTCT
GATTTACGTCCTGGCGAGCTTGGGAGAGACTTCACTGGTTGGAAGTCAATGTATACTGGCGCACCGATTGAGAGA
AAAGAGATGAACGAATGGCTAGGCGACACCATTAGCGCACTCCTTAATGGAAGCTCGCCCGGTCATGTGTTTGAA
GTCGGAACTGGCACTGGCATGATGCTGTTTAATCTCGTCAAAGGGCTGCAGAGCTACGTCGGGCTTGAGCCCTCG
ACTACGGCACTTGACTTTGTCCAGGCAGCTGTTCCCAATATTCCCGGATTAAAAGGGAAGGTGCGGTTGCTGACA
GGGACAGCAGACGATATGAATCGACTTGACAGATTCAACCCTGTGGATGTCGCCGTCATCAACTCGGTAGCGCAG
TACTTCCCAACTCCTGACTATCTGCTCAAGGTTGTTGAGGATCTAATGTGTCTGCAAGGTGCCAAGCGAATTTTC
CTTGGTGATATACGGTCATATGCACTCTACGAGGAATTTCAAGTGAGCCGGGCACTATACAGTCGTACCCAGGGA
CTACCCACTGTGGCCGATATTCGATCACAGATGGCGGAAACGGTTCACATGGAAGAGGAGCTACTGGTAGACCCG
GCCTTTTTCACTTCCCTACCAAGCCGTTTTCCGCATCTTGTCGAGCATGTGGAAATTCTGCCCAAGCGTATGGTA
GCAACCAACGAGCTCAGCTGTTACCGCTATGCCGCTGTTCTGTACGCCAAGCAGCAGCCGAACTTGGGGCTGCGC
ATCCACGACGTTGAAGAGAGCCAATGGGTTGATTTTTCCGCAAGGAAGATGAATCGCGAGTCTCTGTTGCAAAAT
TTGCAGCAACGGGTCCCCGATTCATCAGTGGTGGCAATCAGCAATATCCCCTACAGCAAGATTAACCTGGAACGG
CTTATAGTAGACCAGTTGAAGGACCGCTTGGTTGATAGGGTTGGAGGACCTGGCTGGCTCGCGCCACTCCGTGAA
ACCGCCAAGAAGTTCCCATCTCTTGCAGCCATTGATTTGATAGACCTGGCGGAGAAGACGGGTTTTCAAGTCGAG
ATCAGCTGGGCTCGCCAGCACTCACAACGTGGTGGGCTGGACGCCGTCTTCCACCGCATTGAGCCTGCCCAGAAG
GGCGCAAGGGTGCTATTTCGGTTCCCAACAGACCACCAGGGACGAGCACCTGGTCAATTGAGTAACAACCCACTA
CAACTGTCATCCAATCGAGACATGGAGAAGTGGGTGCGGAAGGCCTTGCAAAAGTCATTGCCACCGTATATGGTC
CCCAGACTGGTCAGGGTTTTGGAGCGAATGCCTATCAACAGCAATGGGAAGATCGACCGCAAGGCTCTGGCAAGC
ATGGTTGCTGGCACTGTATCCCAAAACACTGTGTCAGCTAGAGTCGATCCGCGTGATGATCTGGAACGAGCGTTG
CTTCATCAGTTTACGAAGGCGCTCGGGCAAGATATCGGCGTTCTCGAAAGCTTGTTTGATCATGGGGGCCACTCG
CTGACTGCGATAAAGCTGGTCAATGGGATCAATGAACAGCTCCATACTCGTGCCAGGGCGAGTGACATCTTCGAG
TGTCCTACTGTTGCCGGTCTCGCCGCAAGGATTCGATCCTGGCCGGGATCGATAACGAGACCTGTCGCCTCAACG
TTTTCCCTTGTTGGGGGCAATCTCTCACCTGCCACTTCAGGCGAGCTCGCCAAAATTGGACTGAGTCCCACTGAA
GTTGCTGATATCGTTCCTGTGACAAACACACAGGCCTGGTTCCTTACCCGATGGGCCCCAGTCTCCATGCGCCTT
AATCTCCACGGCAGGATCGATATCAATCAGTGGAGAACGGCTTGTCACGCTGTGGCACAAAAGCACAGTACTCTA
CGCACTTTGTTTACTAGACTCGAAGGGAGATTCGTCCAGGTCATCCTGCGAGCAGTCAACGTTCCATTTACCCAC
AAGTTGACCAGTGATACGGTTTCCGATGAGGCTCATTCTGGGCTTTCTCCGGTCTCCACGAAGCTATATACGAGA
TTTGAACTAGTTTCTCAGTCTCCGACAAGTCACTCGTTCATTGTTCGGTTGTCTCATGCACAATACGACGGGTTT
TCACTCCCGCTCCTCTTTTCCGATTTGGTTGCAGCTTACAATGGTAACCTGCTCTCGCCACCAGTAGCAGTCCCC
TTCTCGGACTACGTATATGGATGTGCATACCACCAATCACCAGATTCGCTGAGCTTCTGGAATGACTATTTGCGG
GGGGCTCGTCTGACCACCTTATCCGATCCAACCCTTTCTGCAGATGACAAGTCTATAGATGTCAAAGCGATCGTG
ACTGGTGAACTTCCCCCATCGTTGCCTGGCATCACGTTCCCCACTCTTGCCAATGCAGCATTCGCTTTCACGCTG
GCGGAGATGGTGTGCAGCCAAGATGTCACATTCGGGCTGGTTCTGAACCTTCGTGACCTACCCATCAACGGCGTG
GAAGCCATCCTTGGACCGTGTATCAACATCAGTCCCGTGCGAGTGCAATCGCAGCAGGCTTGGACAGTCAGCGAT
CTCTGCCACAACTTACATGACAGTTACACCGCGGTTTCTCGTCACGGATACGTCGAATTGCCGGATATTGTTGCC
AACTGCACCGACTGGCCAAGGGACAGTGACTTTGGCTGCCTGATAAATCATTTCCCTCCGAATCGTACCCCTTCG
TTCTCATTGAAAGACGCAGAAGTGGTGGACTTTTCAATGGATTCTCGAATCGATCTGACAGATCAGCTGCTTGTT
CGCTCGATCGTGGGTGAGGGAACTTGGGAAGTACAGGTGCTGACTTCAAGCAACGTGATGAGCGACGAAAAGGCC
TCCGCATTGGCTGAGAGGCTTTTGAAAACGGGGCAGAAATTCTCGCAGTACCCAGAAACACCCTTATCTTCCCAT
CTATTGCGTTAA
Gene >Ani_SJS100_1|g9558.t1
ATGTGGCCGAGCATTTACCTCCCCCTCGAATCTGTTCCGTTGACCACCACTGCCAAAACCGATCGAAAGAAGCTC
CGTCACATTATTTGCGCTTCTACTCGCCAGGATCTGGAGAAAGATCTGACACCGACATCTCCTATCGTGTCACCA
GCGACCGAGCTGGAGATGAAACTTCATCAACTATTTGCTGAAGCTCTGCGTGTCGAGCCAACCTCCTTTGGCGTC
AATCATAGCTTTATCCGTCTTGGCGGCGACTCGGTGACAGCCATGCGTTTAGCCAATCGTTGTAGTCAAATGCAG
TACAGATTGACGATGCAAGATATTCTTCAACACCAAACGGTGGCCAACCTTGCCTCGCAGCTTGATCTGTACAGC
AAGGATAACGCGCCATCCTCTACACCTGCCATTGAACACCGGGCCCCTGAACGGTCTTTCCAACCAGGGAGCGAA
TCTGGCATCCAGGACGAATTTGTCAAAGTGCTGGAAGCCAGCATCAGTGCTACTGATCCTTTAACTGATCGTGGC
GTTGAGTCCGCGACGGCCACACAGTTAGTTGACCGAATCAATGGACAATTCGGCACTAAGATCACTGGCAACGAG
ATTCTCCCAATAATAGCTGCTCTCGCGAGACGGCCTGAGTCCCAGGTGAATGAGCATGTGCCTATACCCAACACA
CCATCTACCGAGCCAGTAGTGCAGTCATTTGCACAGCGCCGCCTATGGTTTCTAGACCAATTGCATCCCGATTCA
ACATGGTATCTCCTGCCCCTTGCCACACGACTGCGCGGTCATCTCAACCTTTCTGCGTTGGAGATAGCCCTCAAT
GCAGTAGTAGAACGCCATGAGCCTCTCCGCACCACGTTTAACAATCAAGGTGGCATTGAAGTGCAAGTAGTCCAT
CCTTTTAGGCCAAAGCCGCTTGAGATAATTGATATGGCGCCCAAGAAAGACCAGGACATTTGGGATGCCTTGCAG
AGCGAACAACGCACCACGTTCAATTTGGAGGACGAACCAGGGTGGAGGCCATTGGTGTTCCGTCTGGGGCCTGAT
GATCATATCTTGTCAATTGTCATGCACCATATTATTTCCGATGGATGGTCGGTCGATATCCTTCGAAACGAACTC
AATATCTTCTACTCCGCAGCAATTCGCTCACGTGCCCCCCTATCACAAGTTGATCCGCTCCCAACGCATTACCGT
GACTTCTCGGCTTGGCAACGGCAGCATGAAGATAAGAGCCAGTCGCGAGTAAAGGTTTGGCTTCAGGAACTTGAT
GGAAGCAAGCCGGCTCAACTCCTCTGTGACAAGCCGCGTCCTGCTATACTCTCCGGTGATGCGGGTCGTCAGACG
GTTGATATCAGTGGTGTGCTCTACCAGAACCTGCAGCGATTTTGCAGGGCCCACCGGGTCACCGCTCATACGGTC
TTGCTTGCTACATTCAGGGCAGCACAATATCGCCTCACAGGTACTAAAGACGCAGTGATCGGCACACCATTTGCA
GGTCGCTATCACCACGAGCTAGAACCACTCATCGGATTCTTCGTCAATCTGCAGTGTATTCGGACGGAGGTCGAG
CATGCGCATACGACGTTTTATCACCTCGTTCAGCAGATTAGAGCGAAAATGCACATGGCGTTCGCTCACCAGGAT
ATCCCTTTCGAGAGGATTGTGTCGGAGCTAGCTGACGAGCGCGACCCCTCCCGTAACCCCCTTGTGCAATTGGTT
TTCGCTGTCCACTCCCAAACAGACTTGGGAACCTTGAGTATCGAAGGTGTGGAGGCTGAACGGCTTACACTGTCT
TCAGCCTCCAGGTTTGACCTCGAATTTCACTTCTACGAGGGTGGAGATTGTTTTCAAGGGGAAATTTTGTATTCT
CTAGACCTGTTTCATCCGGAGACAATCAACTTAGTCCAGTCCACCTTTGTTGATATTCTTGAACACGGAATAAGT
CAGCCTACTACACCTATCGATTTGATGCCTCTCAGAGATGCCGCCGCCACCATGCGAAAGAATGGCCTACTCCAC
ACCCCCAACACCGACTGCCCTCTCGAATCGAGTGTAGTCGATCTGTTTCAACGACAAAGCAAGTGTTGTCCCGAC
AAAGTGGCTGTCAAAGACTCTTTTATGCAGCTTACCTACGAGGAACTAAACTCCAAATCTGATATAGTCGCTGAG
TTTCTAAATACCCAGTCCCTGGAGCCAGGAAGTGTCATTGGTGTCTTTGCAGAACGAAGCTGCGAAGCGATAATT
GCATTCCTGGGCATTCTAAAGGCGAGTCTTGCCTATCTACCGCTCGATGTCAGATCCCCGGTCAGCCGCCTGGAA
AAAATCTTGTCATCTGCCAAAGCGTGCAAGCCTGTTCTTGTTGGTAGTTGTATCGAGTGTCCTAGTCTCACTTCG
GCTGATCATCAGTTTCTTCGTCTTTCAGACCTTCTCAATGGGTCGACTCGAAATGAACTTGACTTTCAGCACACG
GTGAGGCCTAGGATGCCCGGCCCCGACGACGTCGCATATATTGTGTATACATCTGGTTCCACAGGAACGCCCAAG
GGAGTCATAATTCAACACAAGGCGATCATCAGGTTGACACAGTGCACCAACATTATCAGTCATGATGAGGCTGCT
GGGAATATAGCACATATGAGTAATCTTGCTTTTGATATGTCAGTTTGGGAGATATACACAGCACTTCTCAATGGA
GGAACATTGATCTGCATCGACCATATGACTGTATTAGACTACAGGTTGCTCGCTCAGGTCTTGGTGCGGGAGAGT
ATCCGAGTTGCCATGATAACTCCAGCTATGCTAAAGCAGTGCCTTATCGAAGTCCCATCGACCATCAGTTGCTTA
GATATTCTGTTTGTCGCAGGAGACCGTCTGGATCCATCTGACGCCATCAAAGCCCGAACACTGGTCCGAAACGAG
CTGATAAATGCCTATGGGCCAACTGAGAATGGGGTATTGAGCACCATTTACAGGATCCGACAGGATGGGGTCTAT
CCGAATGGCATCCCTATTGGTAGATCTATCAGTAACTCTGGTGCGTACGTGGTAGATCCAAGCTACCGGTTAGTC
CCAATTGGAGTCATCGGTGAGCTTATCGCCGTGGGAGACGGACTGGCCAAAGGGTACGTTGACTCACGGCTCGAT
GCTGGCCGGTTCGTGACGGTCAATATTCCTGGGCAATCACCGACACGAGCATACCGGACCGGAGACTTTGTGCGA
TACCGGCCGACTGATGGCCAGCTTGAATACTTTGGCCGCATGGATCAGCAGGTCAAGATTGGAGGTTTCCGTATC
GAACTTGAGGAGATTGAATATGTGCTCCTTCAGAACTGCAAAGTGAGAGATGCGGTAACGGTCATCCAGCAAAGA
GAAGGCCAGGTTCCGGACATTATGAGCTTTGTCACCGTCCCATTGGATCCAGGCCAGATTGAGGCCACGCAACAG
GATCTCCAGGAGTGGGTTGAAGATAGATTACCGTCTTACATGATTCCTCGCGCCATTCGAGTGCTGGAACGGATG
CCAATCAATAGTAATGGGAAGGTTGACCGTCAGAAGCTGGCAGGAATGACGGATACTCATACTTCTCGCCAGCCT
ATAACAGTCACATTACCACCGCCAGATGATGTGGAACGCGCGGTGCTGGAAGAATTTACAGCAGTGCTCAGGTTG
AAGATGGGAATCACAGACAACTTTTTCAAGGCTGGTGGCCACTCACTACTGGCCACCAGAATGGCCTCTAGGATC
ATGAAACGGCTGGATGTCAAAATCACGGTGAGGGATATATTTGACTTTCCTACTGCTGCCAGCCTTGCAAAGAGG
ATTCGGCAATGTGAACCGAGCAAGTATGTTCAGATATCGCCCGTCGAGCACAAGGGACCCGTAGGGAAAGGGGAA
CCAGGGGAACCCGGGGAACAGAGGGGAGCGGTCATGAAGTTGTCCTTTGCGCAAGGCCGCCTTTGGATGCTGGAG
CAAATGAATCCTGGCCAATCCTGGTACCATGTTCCATTTGCGGTGCGGCTGCACGGCTCTCTACAGCTTGAAGCC
TTAGAGAAGGCTTTTTTCACCCTTGCGGAGCGTCATGAAAGTCTTCGAACGACGTTTGAAAACCAGGGGGCACTT
CCAATACAAGTTGTCCATCCCCATCCGTCCAAGCCTCGGCCCTTGAAGGTTATTGATGCAACCACCAGCCTGAAT
ATGGACTTCATGACTATCCTTCACCACGAACAGACGACTACATTCGACCTCTCTACAGAGCCAGCATGGCGAGTG
GCGATTATTCGCTTGGGACCAGAGACCCACGTGCTTTCCGTGGTCATACACCATATCCTTTGCGATGGTTGGTCA
GTTGGCATCATTCAGAAGGAACTAGCTATATTTTATGCTTCGGCTGTTCGGGGCGAGGTGCCCTCGTCATGTCTT
GCTCCGCTTCCGATCCAGTACCGCGACTTTGCGGCCTGGCAACATGAGGTCAGTCAGGGTCATGAGCATCGACGA
CAGCTGGATTATTGGGTAACCCAGCTGGAGGGGAGCCATCCTGCCGAGTTTCTTTGCGACAAACCACGACCAGCG
TCCTTCGCGGGAGCTGCTGGTGTTCGCCTAATCCAAGTTAAAGACACGACATATACGCAATTGCAGCAGTTCTGC
CAGACAAATCAGGTTACCCCCTTTGTTGTCTTGTTAACGACATTTCGCATCACGCACTACAGGCTGACAGGATCA
ACGGATGCAACAATTGGTACACCTGTTGCCAATCGAAATCGTGAAGAACTCGAAGACCTGGTTGGGTTTTTCGTT
AACCTCCAATGTCTTCGAATTCCAGTCGAGGAGATGTCGTTTCTTGAGCTAGTCCAACAAGTCCGTTCAACTACG
TCTGCAGCATCTGCCAATCAAGATGTGCCGTTCGAGCACATTGTAAGTACTATGCAAACTGACCGTGATCTTTCC
CGGAATCCCTTAGTTCAGGTAGTTTTTGTTCTTCACTCTGAAGTAAACATGGCTGCATTCCGTCTCGAGGGGATT
GAAACTAAGCCGGTCGATCTCGTACCGACTTCGCGGTTTGATATGGAGTTCCACCTGTACCAAAGACACAATGCG
CTTGAAGGCTACATCCTCTACGCCGAATCGTTATTCAACGCAGAAACGATTGAGATTATACAGCGAACATTTGAT
AAGGTCCTCCAGCACGGTCTCCTGCTACCCTCTACCACGCCTGACGCATTTCCGCTGGTGGACGACTACACCAGC
CCGGACGCAGATACTATGAAACAGGTCTACGGTCATTGCACAGACTATCCACGAGATATGAACGTCATTGAAGCT
TTTCAGCGGCAGGTGGCGAGTTTCCCAAGTCGCATAGCAGTCACAGATCAGTCAGCGCGACTGACGTATTCCGAG
CTGGATAGCCGGTCAGACCGGGTTGCATCCTGGCTGTCGGCGCTCTCGCTTCCCGTGGAAATGCCGGTGGCGGTG
CTCGCACATCGATCATGTGAAGCTACTGTTGCTCTTCTTGGGATCCTCAAAGCAACCTTGGCATATCTTCCACTA
GATGTTCGAGCCCCCGCAGGCCGCATCGAAACTGTTCTCTCACTCGTACCCAACTGCAAACTGCTTCTGCTAGGA
TCTGGTCTTCGGAATCCTGTAGCCAAACTGGAAGGGATCACAGCAAAGCCGATCACCGAGGCTAGCATGGAATTT
AACCACCTTCTTTCCCGACCGTCGGCCACCAGCCTTGCGTACATCATGTTTACTTCCGGATCGACGGGACAGCCA
AAGGGTGTCATGGTGGAACATCGTGGGATTATCCGATTGGTGAAGGGTAGCGACGTGGCGAGCGAGGCCTGCTCT
GTCGCTCACATGTCGAATCTGGCCTTCGATGCCTCCACATGGGAAATATATATTGCGCTGCTGAATGGCGGCACC
GTGGTGTGCATCGATCCGATGACAGTGGCAGATTATTCTGCGCTTGGTGAAGTGTTTCAGCATGAGAGTGTCCGC
ATGGCATTCTTTACACCGGCACTACTCAAGCAATGCCTAACTGTGTCTCCTGCGACGGTGAGTATGCTAGACACC
CTGGTCACAGGAGGCGACGTACTTGATCCAGACGATGTGGTCAAGGTGAAGCGACTACCGAAGCAGCCTCGTGTT
ATTAATGGATATGGGCCAACCGAAAACACGGTATTCAGCACAATGTATTGCATACCACCGGGGATGATGCATGTG
TTAACGGGGTTCCAATTGGTCAACCAATCTTCAACTCTGGAGCCTGTGTAGTGGATCGCGACCTCCGGGTTGTGC
CTGTTGGTACAATTGGCGAGCTCATTGTTACGGGAGACGGTCTGGCCCGAGGCTATACACAGCCAAAATTGGACC
AGGGGAGATTTATAACTCTGCCGGTCGGCCCGAAAACAGTGCGAGGGTATCGCACCGGCGATATTGTTCGATATC
GGCCTGGTGACCGCCAGTTGGAGTACTTTGGGCGCATCGATCAACAGGTGAAAATCCGTGGCCATCGGGTGGAAC
TTACTGAGATCGACCAATCTTTGCTCGCTTTCAGCTTCATCAAGGAGGCTGTATCAATCTGCCGTAAAGAGGAAG
CCCGGGGACCTGATTTGGTTAGCTTCGTTACAGCCGATAACGGTCAGGATTCGCACGCAATCATGGGAGGAGTCA
GGCAGGACACGACTGGGCAAGTCGAAGACTGGAAAGAACTGTTCGAAACAAATGTTTATAATCCCTCTGATTTAC
GTCCTGGCGAGCTTGGGAGAGACTTCACTGGTTGGAAGTCAATGTATACTGGCGCACCGATTGAGAGAAAAGAGA
TGAACGAATGGCTAGGCGACACCATTAGCGCACTCCTTAATGGAAGCTCGCCCGGTCATGTGTTTGAAGTCGGAA
CTGGCACTGGCATGATGCTGTTTAATCTCGTCAAAGGGCTGCAGAGCTACGTCGGGCTTGAGCCCTCGACTACGG
CACTTGACTTTGTCCAGGCAGCTGTTCCCAATATTCCCGGATTAAAAGGGAAGGTGCGGTTGCTGACAGGGACAG
CAGACGATATGAATCGACTTGACAGATTCAACCCTGTGGATGTCGCCGTCATCAACTCGGTAGCGCAGTACTTCC
CAACTCCTGACTATCTGCTCAAGGTTGTTGAGGATCTAATGTGTCTGCAAGGTGCCAAGCGAATTTTCCTTGGTG
ATATACGGTCATATGCACTCTACGAGGAATTTCAAGTGAGCCGGGCACTATACAGTCGTACCCAGGGACTACCCA
CTGTGGCCGATATTCGATCACAGATGGCGGAAACGGTTCACATGGAAGAGGAGCTACTGGTAGACCCGGCCTTTT
TCACTTCCCTACCAAGCCGTTTTCCGCATCTTGTCGAGCATGTGGAAATTCTGCCCAAGCGTATGGTAGCAACCA
ACGAGCTCAGCTGTTACCGCTATGCCGCTGTTCTGTACGCCAAGCAGCAGCCGAACTTGGGGCTGCGCATCCACG
ACGTTGAAGAGAGCCAATGGGTTGATTTTTCCGCAAGGAAGATGAATCGCGAGTCTCTGTTGCAAAATTTGCAGC
AACGGGTCCCCGATTCATCAGTGGTGGCAATCAGCAATATCCCCTACAGCAAGATTAACCTGGAACGGCTTATAG
TAGACCAGTTGAAGGACCGCTTGGTTGATAGGGTTGGAGGACCTGGCTGGCTCGCGCCACTCCGTGAAACCGCCA
AGAAGTTCCCATCTCTTGCAGCCATTGATTTGATAGACCTGGCGGAGAAGACGGGTTTTCAAGTCGAGATCAGCT
GGGCTCGCCAGCACTCACAACGTGGTGGGCTGGACGCCGTCTTCCACCGCATTGAGCCTGCCCAGAAGGGCGCAA
GGGTGCTATTTCGGTTCCCAACAGACCACCAGGGACGAGCACCTGGTCAATTGAGTAACAACCCACTACAACTGT
CATCCAATCGAGACATGGAGAAGTGGGTGCGGAAGGCCTTGCAAAAGTCATTGCCACCGTATATGGTCCCCAGAC
TGGTCAGGGTTTTGGAGCGAATGCCTATCAACAGCAATGGGAAGATCGACCGCAAGGCTCTGGCAAGCATGGTTG
CTGGCACTGTATCCCAAAACACTGTGTCAGCTAGAGTCGATCCGCGTGATGATCTGGAACGAGCGTTGCTTCATC
AGTTTACGAAGGCGCTCGGGCAAGATATCGGCGTTCTCGAAAGCTTGTTTGATCATGGGGGCCACTCGCTGACTG
CGATAAAGCTGGTCAATGGGATCAATGAACAGCTCCATACTCGTGCCAGGGCGAGTGACATCTTCGAGTGTCCTA
CTGTTGCCGGTCTCGCCGCAAGGATTCGATCCTGGCCGGGATCGATAACGAGACCTGTCGCCTCAACGTTTTCCC
TTGTTGGGGGCAATCTCTCACCTGCCACTTCAGGCGAGCTCGCCAAAATTGGACTGAGTCCCACTGAAGTTGCTG
ATATCGTTCCTGTGACAAACACACAGGCCTGGTTCCTTACCCGATGGGCCCCAGTCTCCATGCGCCTTAATCTCC
ACGGCAGGATCGATATCAATCAGTGGAGAACGGCTTGTCACGCTGTGGCACAAAAGCACAGTACTCTACGCACTT
TGTTTACTAGACTCGAAGGGAGATTCGTCCAGGTCATCCTGCGAGCAGTCAACGTTCCATTTACCCACAAGTTGA
CCAGTGATACGGTTTCCGATGAGGCTCATTCTGGGCTTTCTCCGGTCTCCACGAAGCTATATACGAGATTTGAAC
TAGTTTCTCAGTCTCCGACAAGTCACTCGTTCATTGTTCGGTTGTCTCATGCACAATACGACGGGTTTTCACTCC
CGCTCCTCTTTTCCGATTTGGTTGCAGCTTACAATGGTAACCTGCTCTCGCCACCAGTAGCAGTCCCCTTCTCGG
ACTACGTATATGGATGTGCATACCACCAATCACCAGATTCGCTGAGCTTCTGGAATGACTATTTGCGGGGGGCTC
GTCTGACCACCTTATCCGATCCAACCCTTTCTGCAGATGACAAGTCTATAGATGTCAAAGCGATCGTGACTGGTG
AACTTCCCCCATCGTTGCCTGGCATCACGTTCCCCACTCTTGCCAATGCAGCATTCGCTTTCACGCTGGCGGAGA
TGGTGTGCAGCCAAGATGTCACATTCGGGCTGGTTCTGAACCTTCGTGACCTACCCATCAACGGCGTGGAAGCCA
TCCTTGGACCGTGTATCAACATCAGTCCCGTGCGAGTGCAATCGCAGCAGGCTTGGACAGTCAGCGATCTCTGCC
ACAACTTACATGACAGTTACACCGCGGTTTCTCGTCACGGATACGTCGAATTGCCGGATATTGTTGCCAACTGCA
CCGACTGGCCAAGGGACAGTGACTTTGGCTGCCTGATAAATCATTTCCCTCCGAATCGTACCCCTTCGTTCTCAT
TGAAAGACGCAGAAGTGGTGGACTTTTCAATGGATTCTCGAATCGATCTGACAGATCAGCTGCTTGTTCGCTCGA
TCGTGGGTGAGGGAACTTGGGAAGTACAGGTGCTGACTTCAAGCAACGTGATGAGCGACGAAAAGGCCTCCGCAT
TGGCTGAGAGGCTTTTGAAAACGGGGCAGAAATTCTCGCAGTACCCAGAAACACCCTTATCTTCCCATCTATTGC
GTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail