Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9381.t1
Gene name
Locationscaffold_084:113095..116024
Strand-
Gene length (bp)2929
Transcript length (bp)2877
Coding sequence length (bp)2877
Protein length (aa) 959

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00924 MS_channel Mechanosensitive ion channel 2.5E-20 489 652

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 133 155 22
2 160 182 22
3 214 236 22
4 260 282 22
5 489 511 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9381.t1
MPFSKFMSGRPGITEKRLSAHRFQQLPDMAPDNMMNLNDVTIDIPLNPVPSRNQTGARKTSSNVGGSPNPYQPPG
DDKGIDGEKESLVAPNPGMRRRIDESTGRSLEDPEDGTVTRMGRIYQAILNYSVLTRYFIYVAPLAILLAIPIIV
GATVAQDATIGGVTLPWFWFWIEIVWISLWLCKLAAKLLPYIFQTLIGFVSSGTRKYALILRKLEMPIATVLWCV
VCLVTFLPVMTQNPHQKAKGDTSTKSWEKSIKNILFALFVCSLIFLAEKTMVHLISISYHRKQFDARIKESKRNV
YLVALLFDASRHMFPMYCKEFQEEDAAISDSILRSAAIKTRTGSSSAPLRLIRGVGQNVHQFGNKVTAAFGDVAH
ELTGKQVFNPTSTRSVVTQALEHRRTSEALARRIWMSFVIEGRDALYFDDICEVLGAGMEAEAEECFHMLDRDGN
GDISLEEMILAIGEVRRLRKSLNNSLHDVDQAIHVLDNLLLTVAGIIAILVFVSFVTSGFGTVIAAGATSLLSLS
FVFSTTAQEVLGSCIFLFVKHPFDVGDRVEISDKPYFVERISLLFTVFRNVNDHRITQVPNVVLNTLWIDNFTRA
NAMHERLTVPVSFETTFSNVQLLQEEMESFVRDKDNCRDFQPEVTIDVVGLGDMDKMELSVLICHKSNWSNEAVR
AARRSKFMCALISAVRKVPIRAPGASDDADDDKTEKDDNKSDAGQGDQTLPVRQVSIASEGMRRANTTAGVSYTE
SRSTGFDLGNSPQSLQRRGMGASSSYSEGLTAEHAARSQDGSRDGHEVDHYQTPVGSPGQERQLNVTYGLMTREP
STGRRKEGRSSYVEPEPEPQPVVAPRGDVPVLSEPVPPRHRQEAQPTLPQVAVPQPLAGAAVSQPPQQPPEYYNY
PGQYYDPSEDPYDPNQPFELPSMHEQTPDGREHPSTHLTETEPGRYVPRRPYEGAGNQ*
Coding >Ani_SJS100_1|g9381.t1
ATGCCATTTTCAAAATTCATGTCCGGCAGACCTGGTATCACGGAGAAGCGGCTGTCGGCTCATCGCTTCCAGCAG
CTTCCCGACATGGCCCCGGATAATATGATGAATCTTAACGACGTCACTATCGACATCCCCTTGAACCCGGTTCCC
AGTCGGAATCAGACCGGCGCTCGCAAGACAAGTAGCAATGTGGGAGGCTCGCCGAATCCGTATCAACCACCCGGC
GATGACAAAGGCATTGACGGTGAGAAGGAGAGCTTGGTTGCGCCAAACCCTGGCATGCGCCGACGCATTGACGAA
AGCACTGGACGTTCACTAGAAGACCCCGAGGATGGCACCGTCACTCGCATGGGCCGCATCTACCAGGCCATCCTG
AATTACTCTGTCCTCACCCGCTACTTCATCTATGTGGCCCCGCTCGCAATTCTACTCGCCATCCCCATTATCGTG
GGAGCAACGGTCGCGCAGGACGCGACTATCGGCGGAGTTACTCTGCCTTGGTTCTGGTTCTGGATTGAGATCGTC
TGGATCAGTCTGTGGTTGTGCAAACTGGCAGCCAAACTCTTGCCGTACATCTTCCAAACCCTCATCGGGTTTGTG
AGTTCAGGAACTCGGAAATATGCTCTCATTCTACGCAAACTGGAAATGCCAATTGCAACCGTGCTGTGGTGCGTG
GTGTGCTTGGTCACCTTTTTGCCTGTCATGACACAAAATCCCCATCAGAAAGCCAAGGGGGATACCTCTACCAAA
TCCTGGGAGAAGTCTATCAAGAACATCCTGTTTGCCCTCTTCGTCTGCAGCTTGATTTTCCTGGCCGAGAAAACC
ATGGTTCATCTCATCTCGATCAGCTACCACCGCAAGCAGTTCGATGCCCGCATCAAAGAATCGAAGCGCAATGTG
TATCTAGTGGCTCTGTTGTTCGACGCCTCGCGCCACATGTTCCCCATGTACTGCAAAGAGTTCCAAGAGGAAGAC
GCTGCCATTTCCGACTCCATTCTTCGCTCCGCCGCCATCAAGACCCGCACTGGTAGCTCATCAGCGCCTTTGCGC
CTTATCCGGGGCGTGGGCCAAAATGTCCACCAGTTCGGTAACAAAGTTACGGCGGCTTTCGGCGACGTGGCACAT
GAATTGACTGGCAAGCAAGTTTTCAACCCCACCTCCACTCGGTCCGTCGTCACCCAGGCTCTGGAACACAGACGG
ACGTCGGAGGCGCTAGCCCGAAGAATTTGGATGTCTTTCGTCATCGAAGGCCGTGATGCTCTGTACTTTGACGAT
ATCTGTGAGGTCCTAGGAGCTGGCATGGAGGCGGAGGCCGAGGAATGTTTCCACATGCTGGATCGCGACGGCAAC
GGGGACATCAGCTTGGAGGAGATGATCTTGGCCATCGGGGAAGTCCGCCGGTTGAGAAAGTCCCTGAACAACAGT
CTCCACGATGTTGACCAGGCGATCCACGTTCTGGACAACCTCTTGCTGACCGTGGCGGGTATCATCGCTATTTTG
GTCTTTGTGTCTTTCGTGACCAGTGGCTTCGGTACCGTTATCGCGGCGGGTGCCACTTCCCTGCTTTCTCTGAGT
TTCGTCTTCTCGACCACCGCACAGGAGGTGCTGGGTTCGTGTATCTTCCTCTTCGTCAAGCATCCCTTTGACGTG
GGCGACCGTGTGGAAATCAGCGACAAGCCGTACTTTGTCGAGCGCATCTCCTTGCTGTTCACCGTGTTCCGGAAC
GTCAACGACCACCGCATCACGCAGGTTCCGAACGTCGTCCTCAACACCCTATGGATTGACAACTTCACCCGTGCC
AATGCTATGCATGAGCGCCTCACCGTGCCCGTCAGCTTCGAGACCACCTTCTCCAACGTCCAGCTTCTCCAAGAG
GAGATGGAGAGCTTCGTACGCGACAAGGACAACTGCCGCGACTTCCAACCAGAGGTCACCATTGATGTAGTGGGC
CTGGGTGACATGGACAAGATGGAGCTGAGTGTCTTGATTTGCCACAAATCCAACTGGTCGAACGAAGCTGTCCGT
GCTGCCCGTCGCTCGAAGTTCATGTGCGCTTTGATTTCTGCTGTGCGCAAGGTCCCTATTCGCGCTCCAGGCGCC
AGCGACGACGCCGATGATGACAAAACCGAGAAGGATGACAACAAGTCGGATGCCGGACAAGGAGACCAAACCCTA
CCCGTCCGCCAGGTCTCCATCGCCAGCGAAGGCATGCGACGGGCTAACACTACGGCTGGCGTCTCTTACACCGAA
TCCCGCTCCACTGGCTTCGACCTCGGCAACTCCCCGCAGTCACTGCAGCGTCGTGGCATGGGCGCCTCCAGCTCC
TACAGTGAAGGCCTCACCGCAGAGCACGCAGCCCGGTCGCAGGACGGCTCCCGCGACGGTCACGAAGTCGACCAC
TACCAGACGCCCGTGGGATCTCCCGGTCAGGAGCGCCAACTCAACGTGACCTACGGACTCATGACTCGCGAACCG
TCAACGGGTCGTCGCAAGGAAGGCCGTAGCTCGTACGTCGAGCCTGAACCCGAGCCCCAGCCTGTGGTCGCCCCT
CGAGGCGATGTCCCGGTGCTCTCGGAGCCAGTCCCTCCTCGTCATCGCCAGGAGGCGCAGCCCACGCTGCCCCAG
GTCGCAGTGCCCCAGCCTCTCGCGGGGGCCGCAGTGTCCCAGCCGCCTCAGCAGCCGCCCGAGTATTACAACTAC
CCGGGACAGTACTACGACCCATCGGAGGACCCATACGACCCGAACCAGCCGTTCGAGCTTCCGTCGATGCACGAG
CAGACGCCAGACGGACGGGAGCACCCCTCGACGCATCTGACAGAAACCGAGCCAGGACGGTATGTGCCACGACGG
CCGTACGAGGGAGCGGGTAACCAGTAG
Transcript >Ani_SJS100_1|g9381.t1
ATGCCATTTTCAAAATTCATGTCCGGCAGACCTGGTATCACGGAGAAGCGGCTGTCGGCTCATCGCTTCCAGCAG
CTTCCCGACATGGCCCCGGATAATATGATGAATCTTAACGACGTCACTATCGACATCCCCTTGAACCCGGTTCCC
AGTCGGAATCAGACCGGCGCTCGCAAGACAAGTAGCAATGTGGGAGGCTCGCCGAATCCGTATCAACCACCCGGC
GATGACAAAGGCATTGACGGTGAGAAGGAGAGCTTGGTTGCGCCAAACCCTGGCATGCGCCGACGCATTGACGAA
AGCACTGGACGTTCACTAGAAGACCCCGAGGATGGCACCGTCACTCGCATGGGCCGCATCTACCAGGCCATCCTG
AATTACTCTGTCCTCACCCGCTACTTCATCTATGTGGCCCCGCTCGCAATTCTACTCGCCATCCCCATTATCGTG
GGAGCAACGGTCGCGCAGGACGCGACTATCGGCGGAGTTACTCTGCCTTGGTTCTGGTTCTGGATTGAGATCGTC
TGGATCAGTCTGTGGTTGTGCAAACTGGCAGCCAAACTCTTGCCGTACATCTTCCAAACCCTCATCGGGTTTGTG
AGTTCAGGAACTCGGAAATATGCTCTCATTCTACGCAAACTGGAAATGCCAATTGCAACCGTGCTGTGGTGCGTG
GTGTGCTTGGTCACCTTTTTGCCTGTCATGACACAAAATCCCCATCAGAAAGCCAAGGGGGATACCTCTACCAAA
TCCTGGGAGAAGTCTATCAAGAACATCCTGTTTGCCCTCTTCGTCTGCAGCTTGATTTTCCTGGCCGAGAAAACC
ATGGTTCATCTCATCTCGATCAGCTACCACCGCAAGCAGTTCGATGCCCGCATCAAAGAATCGAAGCGCAATGTG
TATCTAGTGGCTCTGTTGTTCGACGCCTCGCGCCACATGTTCCCCATGTACTGCAAAGAGTTCCAAGAGGAAGAC
GCTGCCATTTCCGACTCCATTCTTCGCTCCGCCGCCATCAAGACCCGCACTGGTAGCTCATCAGCGCCTTTGCGC
CTTATCCGGGGCGTGGGCCAAAATGTCCACCAGTTCGGTAACAAAGTTACGGCGGCTTTCGGCGACGTGGCACAT
GAATTGACTGGCAAGCAAGTTTTCAACCCCACCTCCACTCGGTCCGTCGTCACCCAGGCTCTGGAACACAGACGG
ACGTCGGAGGCGCTAGCCCGAAGAATTTGGATGTCTTTCGTCATCGAAGGCCGTGATGCTCTGTACTTTGACGAT
ATCTGTGAGGTCCTAGGAGCTGGCATGGAGGCGGAGGCCGAGGAATGTTTCCACATGCTGGATCGCGACGGCAAC
GGGGACATCAGCTTGGAGGAGATGATCTTGGCCATCGGGGAAGTCCGCCGGTTGAGAAAGTCCCTGAACAACAGT
CTCCACGATGTTGACCAGGCGATCCACGTTCTGGACAACCTCTTGCTGACCGTGGCGGGTATCATCGCTATTTTG
GTCTTTGTGTCTTTCGTGACCAGTGGCTTCGGTACCGTTATCGCGGCGGGTGCCACTTCCCTGCTTTCTCTGAGT
TTCGTCTTCTCGACCACCGCACAGGAGGTGCTGGGTTCGTGTATCTTCCTCTTCGTCAAGCATCCCTTTGACGTG
GGCGACCGTGTGGAAATCAGCGACAAGCCGTACTTTGTCGAGCGCATCTCCTTGCTGTTCACCGTGTTCCGGAAC
GTCAACGACCACCGCATCACGCAGGTTCCGAACGTCGTCCTCAACACCCTATGGATTGACAACTTCACCCGTGCC
AATGCTATGCATGAGCGCCTCACCGTGCCCGTCAGCTTCGAGACCACCTTCTCCAACGTCCAGCTTCTCCAAGAG
GAGATGGAGAGCTTCGTACGCGACAAGGACAACTGCCGCGACTTCCAACCAGAGGTCACCATTGATGTAGTGGGC
CTGGGTGACATGGACAAGATGGAGCTGAGTGTCTTGATTTGCCACAAATCCAACTGGTCGAACGAAGCTGTCCGT
GCTGCCCGTCGCTCGAAGTTCATGTGCGCTTTGATTTCTGCTGTGCGCAAGGTCCCTATTCGCGCTCCAGGCGCC
AGCGACGACGCCGATGATGACAAAACCGAGAAGGATGACAACAAGTCGGATGCCGGACAAGGAGACCAAACCCTA
CCCGTCCGCCAGGTCTCCATCGCCAGCGAAGGCATGCGACGGGCTAACACTACGGCTGGCGTCTCTTACACCGAA
TCCCGCTCCACTGGCTTCGACCTCGGCAACTCCCCGCAGTCACTGCAGCGTCGTGGCATGGGCGCCTCCAGCTCC
TACAGTGAAGGCCTCACCGCAGAGCACGCAGCCCGGTCGCAGGACGGCTCCCGCGACGGTCACGAAGTCGACCAC
TACCAGACGCCCGTGGGATCTCCCGGTCAGGAGCGCCAACTCAACGTGACCTACGGACTCATGACTCGCGAACCG
TCAACGGGTCGTCGCAAGGAAGGCCGTAGCTCGTACGTCGAGCCTGAACCCGAGCCCCAGCCTGTGGTCGCCCCT
CGAGGCGATGTCCCGGTGCTCTCGGAGCCAGTCCCTCCTCGTCATCGCCAGGAGGCGCAGCCCACGCTGCCCCAG
GTCGCAGTGCCCCAGCCTCTCGCGGGGGCCGCAGTGTCCCAGCCGCCTCAGCAGCCGCCCGAGTATTACAACTAC
CCGGGACAGTACTACGACCCATCGGAGGACCCATACGACCCGAACCAGCCGTTCGAGCTTCCGTCGATGCACGAG
CAGACGCCAGACGGACGGGAGCACCCCTCGACGCATCTGACAGAAACCGAGCCAGGACGGTATGTGCCACGACGG
CCGTACGAGGGAGCGGGTAACCAGTAG
Gene >Ani_SJS100_1|g9381.t1
ATGCCATTTTCAAAATTCATGTCCGGCAGACCTGGTATCACGGAGAAGCGGCTGTCGGCTCATCGCTTCCAGCAG
CTTCCCGACATGGCCCCGGATAATATGATGAATCTTAACGACGTCACTATCGACATCCCCTTGAACCCGGTTCCC
AGTCGGAATCAGACCGGCGCTCGCAAGACAAGTAGCAATGTGGGAGGCTCGCCGAATCCGTATCAACCACCCGGC
GATGACAAAGGCATTGACGGTGAGAAGGAGAGCTTGGTTGCGCCAAACCCTGGCATGCGCCGACGCATTGACGAA
AGCACTGGACGTTCACTAGAAGACCCCGAGGATGGCACCGTCACTCGCATGGGCCGCATCTACCAGGCCATCCTG
AATTACTCTGTCCTCACCCGCTACTTCATCTATGTGGCCCCGCTCGCAATTCTACTCGCCATCCCCATTATCGTG
GGAGCAACGGTCGCGCAGGACGCGACTATCGGCGGAGTTACTCTGCCTTGGTTCTGGTTCTGGATTGAGATCGTC
TGGATCAGTCTGTGGTTGTGCAAACTGGCAGCCAAACTCTTGCCGTACATCTTCCAAACCCTCATCGGGTTTGTG
AGTTCAGGAACTCGGAAATATGCTCTCATTCTACGCAAACTGGAAATGCCAATTGCAACCGTGCTGTGGTGCGTG
GTGTGCTTGGTCACCTTTTTGCCTGTAAGTCTCGCTTGATCTTCCTGATACGTGCCCCCGACTAATTTCCATCTA
GGTCATGACACAAAATCCCCATCAGAAAGCCAAGGGGGATACCTCTACCAAATCCTGGGAGAAGTCTATCAAGAA
CATCCTGTTTGCCCTCTTCGTCTGCAGCTTGATTTTCCTGGCCGAGAAAACCATGGTTCATCTCATCTCGATCAG
CTACCACCGCAAGCAGTTCGATGCCCGCATCAAAGAATCGAAGCGCAATGTGTATCTAGTGGCTCTGTTGTTCGA
CGCCTCGCGCCACATGTTCCCCATGTACTGCAAAGAGTTCCAAGAGGAAGACGCTGCCATTTCCGACTCCATTCT
TCGCTCCGCCGCCATCAAGACCCGCACTGGTAGCTCATCAGCGCCTTTGCGCCTTATCCGGGGCGTGGGCCAAAA
TGTCCACCAGTTCGGTAACAAAGTTACGGCGGCTTTCGGCGACGTGGCACATGAATTGACTGGCAAGCAAGTTTT
CAACCCCACCTCCACTCGGTCCGTCGTCACCCAGGCTCTGGAACACAGACGGACGTCGGAGGCGCTAGCCCGAAG
AATTTGGATGTCTTTCGTCATCGAAGGCCGTGATGCTCTGTACTTTGACGATATCTGTGAGGTCCTAGGAGCTGG
CATGGAGGCGGAGGCCGAGGAATGTTTCCACATGCTGGATCGCGACGGCAACGGGGACATCAGCTTGGAGGAGAT
GATCTTGGCCATCGGGGAAGTCCGCCGGTTGAGAAAGTCCCTGAACAACAGTCTCCACGATGTTGACCAGGCGAT
CCACGTTCTGGACAACCTCTTGCTGACCGTGGCGGGTATCATCGCTATTTTGGTCTTTGTGTCTTTCGTGACCAG
TGGCTTCGGTACCGTTATCGCGGCGGGTGCCACTTCCCTGCTTTCTCTGAGTTTCGTCTTCTCGACCACCGCACA
GGAGGTGCTGGGTTCGTGTATCTTCCTCTTCGTCAAGCATCCCTTTGACGTGGGCGACCGTGTGGAAATCAGCGA
CAAGCCGTACTTTGTCGAGCGCATCTCCTTGCTGTTCACCGTGTTCCGGAACGTCAACGACCACCGCATCACGCA
GGTTCCGAACGTCGTCCTCAACACCCTATGGATTGACAACTTCACCCGTGCCAATGCTATGCATGAGCGCCTCAC
CGTGCCCGTCAGCTTCGAGACCACCTTCTCCAACGTCCAGCTTCTCCAAGAGGAGATGGAGAGCTTCGTACGCGA
CAAGGACAACTGCCGCGACTTCCAACCAGAGGTCACCATTGATGTAGTGGGCCTGGGTGACATGGACAAGATGGA
GCTGAGTGTCTTGATTTGCCACAAATCCAACTGGTCGAACGAAGCTGTCCGTGCTGCCCGTCGCTCGAAGTTCAT
GTGCGCTTTGATTTCTGCTGTGCGCAAGGTCCCTATTCGCGCTCCAGGCGCCAGCGACGACGCCGATGATGACAA
AACCGAGAAGGATGACAACAAGTCGGATGCCGGACAAGGAGACCAAACCCTACCCGTCCGCCAGGTCTCCATCGC
CAGCGAAGGCATGCGACGGGCTAACACTACGGCTGGCGTCTCTTACACCGAATCCCGCTCCACTGGCTTCGACCT
CGGCAACTCCCCGCAGTCACTGCAGCGTCGTGGCATGGGCGCCTCCAGCTCCTACAGTGAAGGCCTCACCGCAGA
GCACGCAGCCCGGTCGCAGGACGGCTCCCGCGACGGTCACGAAGTCGACCACTACCAGACGCCCGTGGGATCTCC
CGGTCAGGAGCGCCAACTCAACGTGACCTACGGACTCATGACTCGCGAACCGTCAACGGGTCGTCGCAAGGAAGG
CCGTAGCTCGTACGTCGAGCCTGAACCCGAGCCCCAGCCTGTGGTCGCCCCTCGAGGCGATGTCCCGGTGCTCTC
GGAGCCAGTCCCTCCTCGTCATCGCCAGGAGGCGCAGCCCACGCTGCCCCAGGTCGCAGTGCCCCAGCCTCTCGC
GGGGGCCGCAGTGTCCCAGCCGCCTCAGCAGCCGCCCGAGTATTACAACTACCCGGGACAGTACTACGACCCATC
GGAGGACCCATACGACCCGAACCAGCCGTTCGAGCTTCCGTCGATGCACGAGCAGACGCCAGACGGACGGGAGCA
CCCCTCGACGCATCTGACAGAAACCGAGCCAGGACGGTATGTGCCACGACGGCCGTACGAGGGAGCGGGTAACCA
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail