Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9357.t1
Gene name
Locationscaffold_084:20325..41630
Strand+
Gene length (bp)21305
Transcript length (bp)21150
Coding sequence length (bp)21150
Protein length (aa) 7050

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.7E-73 40 445
PF00501 AMP-binding AMP-binding enzyme 2.7E-71 1699 2093
PF00501 AMP-binding AMP-binding enzyme 6.5E-67 3229 3631
PF00501 AMP-binding AMP-binding enzyme 1.9E-68 4320 4718
PF00501 AMP-binding AMP-binding enzyme 9.8E-74 5869 6263
PF00668 Condensation Condensation domain 2.7E-43 692 1095
PF00668 Condensation Condensation domain 2.7E-28 2319 2746
PF00668 Condensation Condensation domain 2.6E-38 2825 3205
PF00668 Condensation Condensation domain 2.0E-43 3877 4297
PF00668 Condensation Condensation domain 2.5E-31 4948 5368
PF00668 Condensation Condensation domain 6.2E-47 5450 5830
PF00668 Condensation Condensation domain 2.1E-28 6510 6923
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-09 1121 1181
PF00550 PP-binding Phosphopantetheine attachment site 4.6E-06 2238 2299
PF00550 PP-binding Phosphopantetheine attachment site 2.6E-07 3772 3834
PF00550 PP-binding Phosphopantetheine attachment site 7.0E-07 4866 4928
PF00550 PP-binding Phosphopantetheine attachment site 2.1E-11 6402 6466

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9357.t1
MRSPNDLTTSATMEDIHQIWSWNANVPEAGETCVHTLITDKALQQPDALAVDAWDGRWTYGELENTSTKLALRLL
DSGVGPGTNVVICFEKSKYTPLAMLAVMKAGGASIALDTSQPQTRLQSIINQVDPVVILCSASKSQLAKSIIAES
AVALTIDENSLSEMHFEADSVARLPDVSLDNNLYVVFTSGSTGTPKGVVVTHLNYSTAILHQQEAHGFKSTSRVY
DFASYAFDVSWSNLIHTLTIGACLCIPSEQDRKDNLIESIRSLCATHIDVTPSVARLLPDTLLCKIETLVLGGEK
LSAELARHLSSLVTLKNPYGPSECTPTSTIATIRPDDDDSKISSIGRGLGVNTWVVDSENEGILVPIGQVGELLL
EGHLLGNGYLNDQTKTTAAFVNDPLFLLNGGDGPGQPGRHGRLYKTGDLVRYEKDGSLTFIGRKDTQVKINGQRV
ELGDIEHHINRHIPHGTVSVRQIAAEIISPKRGSNAVLAAFLEVDLGVEDTGIAEQLFSKTEKMMSNLRSNLARD
VPSYMVPAVFIPLRNFPLSPTGKTDRRQLRAIGESMDLTVLAGFGAAPNEARIPLTLREKQLRRLWGSILRIDEN
LIALDDNFLQRASNPNAALKLVTAARREGFSLSVANVLKYPRLQDMAHVVETVEQEQAPEIMPFELLSNDINLDL
ALREAAASCNVQGNQIQDIYPCTPLQEGMMSLSAKREGDYIMQYTLGLHHRCDIERLGKAWATVVATTPILRTRI
VDITSQGLVQAVLNEQWSSSSIQRRTLSQARDHKHQFGLGMPLGRFEIVTGDSSDSKHYFVWTLHHALYDGWSLQ
LLLEKLENEYAGKADAQSNSPDFKRFIRYISTRDGEKTHSFWTEQFQDVEAQIFPSLPSVDYQPRSDKLYTHSLE
GIQWPKNGITPSTTIRAAYSILIASLTNSPDVVFGNITTGRQAAVDEVEDLIAPTIATVPVRVSIDSKDELGQFL
QRIQSQAADMIEFEQTGLHQIRHINADAERACQFQTLLVVQPAEGSATAPSNIFTNIADDIRKGDGNSAAELGTY
ALTMECLLRKDGLDLHMNYCSAVISEHQVRRLSQQFEHVLGQICHLTMIIHRQKTTLESLRQPTTETERQMQRIW
AQVLNLNQASIGLDYSFFQLGGDSIAAMEVVTEARKLGLKLAVSDIFHRPKLQDVAKKACDSGLQVYGEDQLMND
SEVQVNGGTEHTKLPDDDKAVAGHETQQVMVWEGMFDKEVYGTIDNVQLEKIGRDFIGWTSMYNGNQMDNVELNE
WLDDTIATIRSSGSTANILELGSGSGMILFNLVNGLHSYVGLDPSEKAVDFVCSTVKSIPQLADRVYNIKGTADN
INSLGVPIFANMVIVNSVVQYFPSQDYLLKVIEDLVQLETVRTIFFGDIRSYALFREFQVTRALHIAGDTATEDE
IRQMMANMEQVELELLVDPAFFTSLVDRFPGLVEHVEILPKRLKSTNELSAYRYAAVVHLKDSNQLAQPLQLHDI
QKESWINYSGRQLNRQSLLQLVQDSFLRDPSPSSVVAVCNIPYSMTVYERHVIEWLDSGLTAGPDAEDWLSSIRQ
TSQECSSLSALDLQQIAHQTGWQVEISWSRQFSQRGGLDAIFHRHHSRGDRTSRALFNFPTDHQGRPSQSLSNWP
LQRKQQGEEKQITLGDVSTVCKEDLHDIWTWNEVVPDALEACVHDLISDTVRAQPQSPAICAWDGEWSYIELDDL
SSRLAHALAPFGVANTVVPICFEKSKWTPVATLAVMKAGAASVTLDASQPLERLRSIISQTDPRVILSSASKQGL
GAQLTKAPNLVVDQHSISTMHITAEPLPTVDPSSKLYIVFTSGTTGVPKGVIITHSNFSSAIRHQQKAHGFKSTS
RIYDFASYAFDVSWSNFIHALTIGACLCIPSDEDRRDDLAGSLERFGATHVDMTPSAASLLPEKSFKRLETVVLG
GEKLSVESAQRWSSLVSLKNPYGPSECTPTATIATVTPTDEYKSSIGRGLGLNTWIVNTATDSLVPVGGVGELLL
EGPLVGAGYLGDDTKTAASFVQDPQFLLQICPQGQARHTRMYKTGDLVHYNPDGSLSFIGRKDAQVKIHGQRVEL
TEIESHIRRISKTIQVAVLFTKSGLCANRVVAFVCIQGTGQTQTAADQIRLIDPKYSTLVTAYTESAKFSLSDTL
PAYMIPSIWIPLQHVPLSTSGKLDYKALKSWLDSMDAKTFANILTASDGDVKLRKAETELEQVIVEACATILNIT
ASKVNLDRSFIANGGDSISAMRLVAHCRADNVVFSVAKLLKSKTLAALASSSEIKSASNVLGFYEEKSDSFALSP
IQQWFFEQGLYKRSNDNFDNQGFYLKVKRPLLTKDIDSAISKVVQHHSMLRARFHRNGDEWTQKTLKPDTNGLYH
FGVQHTCLPADIERLALSRHQMIDIEKGPVFSADICHNAFGEQYLILIAHHLVVDLVSWRVILEDIESLLGGSNL
QPSLPFQVWNDMQIERAKESSLFDPENVLSTTGINNKLDFWQATAETKNTVEDHLNFCIKIDSSITELILKDANY
PFNTEPVDLLLAAVWHAFFKTFPQRDGLTIFIEGHGREPWSSDIDLSRTVGWFTTISPIHVSKSDVHKSVASLVR
VVKDARRLLPANGWAYFASRYLNESGKSAFKSHDSIMEITFNYHGQFQQLENEKGMFENITLSGVCEQGPALPAS
SLIAVEVSIDRGQVTFDISANRYINHQDCISNWIKAIPQSLETISNELVSTAISHRTLCDYEFLSLGYTELDRLQ
ESVIPEIEKLNNSTVEYIYRCLPTVDGILISQFKDPESYKTVQHFEITSHNDDQIDLEHLSLAWQKVVANQPALR
TVFIPGMDKAAAFNQVVLSQYHAELIILRTASDEYTEALEMFKNLTPINYQSFKPPHRVAMCRISPSRVLCQVEM
SHAITDGASTSILANDLLQAYNGNMMPINLMDTACEFARAQLTSSFGEKLSYWKKKLSGMDPCHFPKISGASTQG
TGTSVCKIRGSLFSKIQDYCNSVEVTTASLFQTIWALTLAAYTGNDSTCFGYLASGRDLPIAGIDKSIGAFTNML
TVHDQVMQDLEHQHCSLASIQHELGINSDNPLFNSILSYQKQDDEPAGDEGLVIKALDGQDPTEYDIVLNIGHAT
DHIEIVFDYKHACLSSIQAESVLSLMQSTAAALVQHASGDHQTLRSVNMASTEDISDIWEWNSNVPVTVDDCVHH
IITRTCHERPQAPAICAWDGDWTYAEVNKLSDKLAHLLVSYGVGPEVVVPLCFEKSKWTPIAMMAVMKAGGASVA
MDSTQPEERLRAIVNQVKSPIILSSFANEQLASRLISELPSPIKVLTISDKELENLNVPSGSQLPHVNPSDTLYV
VFTSGSTGVPKGVAVTHSNIASAIKHQRHSLGFTSESRVFDFSSYMFDVVWCNLLQGLSAGSCVCIPSDNERKTD
FMAAIVRMRANLVILTPSAIRGLKLDALNSLCNVHFIGEPLHVDTFRSVDESVTISNLYGPTECTTFSTIQTICG
RQDQSITIGKGAGLNTWVSDIATGTALVPIGSAGELLLEGPLVAAGYRGDAVKTAAAFVYDPPFLLRGSVGHPGR
RGRLYKTGDIVRYNSNGTLTFLGRKDSQVKINGQRVEFGDIESHINGALLPDFSEGQALVEFVTPQGSSRPMLVA
FVYFGPSVTEGMDEADLLSLAKRTAISLDESLAARIPAFMIPSAYIPLQKIPVTATGKTDRRRLREMAKDVTWDQ
LISADSHGPDRCQPGTEMEIQLQILWGTVLGVESSLIGAHDNFMRVGGDSVGAIRLASSARELGFTLNVADILKN
PKLSDMAKLMIRTEPSQDISIKEFSLLKPGSDVDWAVAETSALCGVDGNQVEDLYPCTPLQEGLLALTTKRPGDY
IIRCILELKRSTDVKKFCAAWEAVLESTPILRTRIVDIAEQGLMQAVIKQPAQWTSAETSSLVDFVAADNEKTTG
LGMPLVRFGLVQETNKHFFVLTLHHAVYDGWALNLVFEKLENFYAGSSRHESPDFRHFVKHISSLDNDAAAKFWK
DQLQGSEAPTFPSLPTATFVPKSEKTILHTVEELQWPKTNVTAFTLVRAALSLLTAAYTNSEDVCFGVTSNGRQV
GLPGVERMIGPTIATVPVRVRIDREQRLQAFLTQMQHQSIDMIAFEQFGLQQIRKSSPDAERACNFQSLLIVQPA
EETAQWQSDIIARDIGEGADDPMGIQEIGTYALTLECHLGPDSLLIKANFDSNVIDELQVKRFTKQFEHVLRQIC
CSGSGLVVSDIDTTSRQDMEDIWKWNAVVPQSVNTPVHELISSVARRLPHVQAVCAWDGNWTYRQLDDLSNYVAH
HLVGLGVGSQDIVPLLFEKSKWMPIAMLGVMKAGAASVAVDTSQPKDRLRMIIDQANPTVALSSADKLPLVRSLT
KAQSFVVNGQAIDCLLKPSLNATLPVVDPSSRLYLVFTSGSTGVPKGVIIRHCNFASAIKHQKEVQGILPTSRVY
DFASYAFDVAWANALLTFESGACLCIPSDAERKNDLNGSIARLKPTHADLTPSAALVLSKESLQQLDTLTLGGER
LLAEYATKWSQFVTVKNSYGPSECTPTATFTEAIGRGYDLGASIGKPAGLNTWVVDPVTGQSLVPIGGVGELFLE
GPLVGAGYLNDAEKTNAAFIHDPPFLLRGNVVAQPGRRGTLYKTGDIVRYNSDGSLTFVCRKDTQVKINGQRVEL
AEIESHIALYTATRQVATLLPSTGLCANKLVAMISLTDVNYDVSEDLAENKIELASSEHDQLINEHIEALQSLLR
ESLPQYMIPSLWVVLYNLPMTASGKQDNKALKSWLENMDETLFSKINNANGSDIIRKPDTEDERALIQKCSIVLN
MPVDKINLDKSFIANGGDSISAMRLASHYRTAGISISVSTLLQSKTLADFAAFSGATAITGVSQEEHTDVPFELS
PIQQWFFDQSPFMSQQKHDRFYNQGFYVRLRRTVGINDLESAFLSLVNRHAMLRSRFQHHGGKWKQIIPSHGKRA
LHLNVSQHLSMSEIALLAQERHRQIDIEQGPVFSVDICLLGQQQHLVMIAHHLVTDLVSWRIILDDLETILNGHS
LTAALSFQVWSRLQAERAVSSTLKPHNLLSTDGVHNNLKFWKYTHDTPNCLADHRLRSVTIDRETTAVLLGEANK
AMNTEPVEILLSAVWDAFFRTFSQRNSLTIFNEGHGREAWSDEIDLSSTVGWFTTLSPINIYRNNATSETDMVRL
VKDARRSLPANGWSYFTSRYLNPDGQRAFESHNTVSEVVFNYHGQFQQLESHQALFEDIDLVGVREQGRSISAGS
LFNIEVAIEAMQAHFEFSVNQNIAHQSLINQWIDQIQPSLERICLVLLEANPTHTLCDFKFISLDYQRLDDLTSR
LLPEIESINQSTVEEIFSCSPIVDGMLLSQIKQPESYKTLQRYEVLSSHDHPICLDTLKIAWQKVISRQPALRTV
FIAGLDGSTAFYQALLKECSGDVIVVEAKTEEEALKAFSSLPKVDYQQAKPPHRLTLCQTPDDKVFCQIEMSHTI
TDGASSNILIKDLIDAYGDRLSSTDLDKTTREFASHLLAKPQSQKISYWNTKLKGLEPCRFPSLSSMSREKHECS
SEIGVFVEDKMFAQIQDFCSINQVTPASLLKSAWALTLSTYVQNQSVCFGYLASGRDLPIAGMDESVGAYTNIMV
CRADLDGQQPGVALVRQLQDQLMQDLSFQHISLASIQHELGLASDQQLFNSIVSFQRSGDDNEQSAEEGKLRFKN
IDGLDPTEYDIVLGINQGTRSIEIDLEFSHSCLTSNQAKRILEHLESNIAAILHNEPPALISPQDEQDIWSWNST
VPDMVNICVHDLISKIVFRQPDAPAVCSWDGDFTYAELDNFATRLANSLSKMGIGRGSIVPLCFEKSKWTPVAML
AVMKTGAASVTMDTSQPEERLQSIVAQVDAKLVISSTLKVELAARLTTAPVLAIDKASMKAMADDTPLAAVDPAN
SIYIVFTSGSTGTPKGVIITHTNYSSAIKHQQSEHGFKPSSRVFDFASYAFDVSWSNFLHTLTIGACLCIPSDDD
RKNDPAGAIDRLRCTHVDMTPSAASVLPASTLAKLDTIVLGGEKLSLEYAQRWSALTSVRNPYGPSECTPTSTIT
EINSAEISKGKVSIGKGVGLNTWIVDPATAQHLMPIGIPGELLLEGPLVGAGYLGDPVKTASAFIEDPEFLVKGA
GPGIPGRRGRLYRTGDLVTYNTDGSLSFVGRRDSQIKINGQRVELGDIESHVSANLVSHGSAQVAVEVVSPQASS
NNILVAFVSFDDLNYINLNDEKLLARTKAATEGIREKLATQIPSYMIPSVYIPVTVFPTTATGKTDRRRLREMAS
SLTLEQLTSINQAQQQYQPPTTPLEVALRELWISVLKLGSRKISTTNNFFELGGDSIGAMRLVGAARDHGLSLSV
VDIFKHPKFSEMAALLRSVDKPQSEEPRVFQPTSLLSKDHNKDQILSRLSDFGIDWENVEDILPVTDHQARSIAM
THSASRDLLLYHTLDSKGVPNMRKMRAVCNELVNRYDLLRTLFIAHKDSFLQVVLKAFPVDITVLRIENASLEEC
TEELRLRDRDDELRYGSLLTKIAILHQIRDNEYRLVVRISHAQHDGMSLMKMWNAFEEMYGDGSDDSFHIPSDTS
FQEKSKASFSNYMHAVAGTNREQAKSHWRRLLKGSSMTNLKPHASYALTFGEGPCVARHVPKSIAQGTGFTFPTV
LKAAWAYVLAKHLAKDDVVFCNLTHGRGLPGTQDVFGDCVNIIPTRVSFTDGWTVRDLLSALNTQQIASMEHENI
GTREIVRDCTTWPKWTYAGSIVYHHDFDDGEHIAHNRSMHVEQELDLSHGKVDMTDVHITSKPDNNMFRIELDFA
HGVISERDAELLAAKLTESIIVFCNVMDQPLLSPDQIRYLRTTTLLPSEEPLSATPTNEQLMVASISPTEMQWAL
ESAWRDTFNCRLSPEVKAGKTIFDLGGDLVSASLISAHMERQGYVLSVEDVLGNPTWFLQLTLLTKRSLRDVDV*
Coding >Ani_SJS100_1|g9357.t1
ATGCGATCTCCCAATGATCTTACAACATCAGCAACCATGGAAGATATTCATCAAATATGGTCTTGGAACGCTAAC
GTGCCTGAGGCGGGTGAGACATGCGTTCACACCCTCATCACCGACAAAGCTCTCCAGCAGCCAGATGCACTTGCC
GTCGACGCTTGGGACGGGAGGTGGACGTATGGTGAGCTTGAGAATACTTCTACCAAACTGGCATTGCGTTTGCTT
GACTCTGGAGTTGGCCCTGGAACCAATGTTGTCATATGTTTTGAAAAGTCGAAGTATACGCCTCTGGCTATGCTG
GCCGTCATGAAGGCGGGTGGAGCCTCCATTGCACTCGATACAAGCCAGCCACAGACTCGATTACAGTCTATCATC
AACCAGGTCGACCCTGTAGTGATACTATGCTCCGCGTCCAAGAGCCAGTTGGCCAAGTCAATTATCGCCGAGTCT
GCAGTAGCATTGACAATTGATGAAAATTCTCTATCCGAAATGCATTTCGAGGCGGACTCAGTCGCCCGTCTCCCT
GACGTCAGTCTGGACAACAATCTCTACGTGGTCTTTACCTCCGGAAGTACAGGAACTCCCAAGGGAGTCGTCGTC
ACACATCTCAATTATTCTACTGCCATTCTCCACCAACAAGAAGCGCATGGATTCAAGTCCACTTCAAGAGTGTAT
GACTTTGCTTCGTATGCTTTTGATGTGAGTTGGTCAAATCTCATCCACACCCTCACCATCGGCGCCTGCCTGTGT
ATTCCATCAGAGCAGGACCGTAAGGACAATCTCATCGAGTCCATACGCTCACTGTGTGCTACACATATCGATGTG
ACCCCGTCTGTTGCTCGCCTTCTCCCTGATACCTTGCTCTGCAAGATTGAAACACTTGTTTTAGGTGGCGAAAAG
CTGTCTGCAGAGCTTGCCAGACATTTATCATCGCTAGTAACATTGAAAAATCCGTATGGACCGAGTGAATGTACG
CCTACATCAACTATCGCTACAATTCGACCGGATGATGATGATTCAAAAATTAGCAGCATTGGCCGAGGCTTGGGT
GTCAACACCTGGGTTGTAGACAGTGAGAATGAAGGAATTTTGGTGCCTATTGGACAGGTTGGAGAGCTATTACTT
GAAGGGCATCTGCTTGGCAATGGCTACTTGAACGACCAGACGAAGACCACTGCAGCCTTTGTCAACGATCCGCTT
TTTCTGCTCAATGGCGGCGATGGACCTGGGCAGCCTGGGAGGCACGGGCGTCTCTACAAGACCGGCGACCTGGTC
CGTTACGAGAAAGACGGTAGCTTGACATTTATTGGCCGTAAGGACACGCAAGTCAAGATTAACGGCCAACGAGTT
GAGCTGGGTGATATTGAGCATCATATTAACCGCCACATCCCACATGGTACCGTGTCTGTGCGACAAATTGCAGCA
GAAATTATTTCACCAAAGAGGGGTTCCAATGCTGTCCTGGCAGCATTCCTCGAGGTCGACCTTGGTGTAGAGGAT
ACGGGAATAGCGGAACAGTTGTTTTCAAAAACAGAGAAGATGATGTCTAACTTGAGAAGCAATCTTGCTCGAGAT
GTCCCTTCATATATGGTTCCTGCTGTATTCATTCCGTTGAGGAACTTCCCATTGTCTCCGACAGGCAAGACAGAC
CGACGCCAACTGCGGGCCATTGGTGAATCAATGGACTTGACTGTCTTGGCAGGCTTTGGCGCAGCACCTAATGAG
GCTCGGATCCCTCTCACTCTGCGAGAGAAACAGTTGAGAAGACTCTGGGGCTCTATCCTCAGGATTGACGAAAAC
CTTATTGCTCTCGACGATAACTTTTTGCAAAGAGCCAGCAACCCAAATGCAGCCTTGAAACTCGTCACTGCAGCT
CGAAGAGAAGGCTTCTCCCTGAGCGTGGCCAACGTGCTGAAGTATCCGCGACTTCAGGACATGGCACATGTGGTT
GAAACAGTGGAGCAAGAGCAGGCACCTGAAATTATGCCATTTGAGCTTCTGAGCAATGATATTAATCTTGATCTA
GCCCTCAGAGAGGCTGCAGCATCGTGCAACGTACAAGGGAATCAAATTCAAGACATTTATCCCTGCACACCGCTA
CAGGAAGGCATGATGTCCCTATCCGCAAAACGCGAGGGTGATTACATTATGCAGTATACGCTGGGGCTACACCAT
CGATGCGACATAGAGCGCCTAGGTAAAGCCTGGGCAACAGTAGTTGCTACGACGCCCATTTTGAGAACACGAATT
GTCGACATCACTAGCCAGGGGTTGGTACAGGCTGTTCTAAACGAGCAGTGGTCAAGTTCGTCGATCCAAAGGAGG
ACTTTGAGCCAGGCGAGAGACCACAAGCATCAATTCGGGCTAGGCATGCCACTAGGCAGATTTGAAATTGTCACC
GGCGACTCGTCTGATTCTAAGCACTACTTCGTCTGGACACTGCACCATGCCCTGTATGACGGGTGGTCACTTCAG
CTTTTACTCGAAAAGCTCGAGAACGAGTACGCCGGAAAGGCAGACGCGCAGTCAAACTCACCCGATTTTAAACGT
TTTATCAGGTATATTTCAACGAGGGATGGCGAGAAGACTCATTCATTCTGGACCGAACAGTTCCAAGACGTCGAA
GCCCAGATCTTTCCGAGTTTGCCATCTGTCGACTACCAGCCTAGATCGGACAAACTGTACACTCATTCTTTGGAA
GGAATACAATGGCCGAAAAATGGAATCACCCCATCGACGACAATCCGTGCGGCTTACTCTATCTTGATAGCCAGT
CTGACCAACAGCCCAGATGTTGTCTTCGGCAACATAACGACGGGCAGACAAGCCGCCGTGGATGAGGTTGAAGAC
CTTATTGCACCAACTATAGCCACTGTACCTGTGCGCGTTTCGATCGACAGCAAAGACGAGTTGGGACAGTTCTTA
CAGCGAATTCAATCTCAGGCCGCAGATATGATTGAGTTTGAGCAGACTGGGCTGCATCAGATTCGACATATCAAT
GCAGACGCGGAGCGAGCATGCCAGTTTCAGACACTGCTTGTTGTTCAGCCCGCGGAGGGCTCGGCCACAGCACCG
AGCAACATTTTTACCAACATTGCCGACGACATAAGGAAAGGAGATGGAAACAGCGCCGCAGAGCTGGGGACTTAC
GCCTTGACTATGGAGTGTCTGCTCAGGAAAGATGGCCTTGACCTCCATATGAACTATTGTTCCGCAGTCATATCG
GAGCATCAAGTGCGCCGTTTGTCACAGCAGTTTGAGCATGTCCTTGGTCAAATATGTCATCTGACGATGATAATT
CACAGACAGAAAACAACACTTGAATCGCTGCGGCAGCCAACAACGGAAACTGAGCGGCAGATGCAGCGAATCTGG
GCACAGGTACTCAACCTTAATCAAGCATCAATTGGGCTAGATTACAGCTTTTTCCAACTCGGCGGCGACTCTATT
GCTGCCATGGAAGTTGTGACAGAAGCTCGTAAGCTTGGCTTGAAACTGGCTGTGTCAGACATATTCCATCGCCCG
AAATTGCAAGACGTTGCAAAGAAGGCTTGTGACAGTGGCCTGCAGGTTTATGGAGAAGACCAGCTCATGAACGAC
TCGGAAGTCCAAGTTAATGGAGGCACCGAGCACACTAAGCTACCCGATGATGACAAGGCAGTCGCTGGCCATGAA
ACGCAGCAAGTCATGGTATGGGAGGGAATGTTCGATAAGGAGGTCTATGGAACTATTGATAATGTCCAATTGGAG
AAGATTGGGCGCGACTTCATCGGATGGACGTCCATGTACAATGGCAACCAAATGGACAATGTCGAATTGAACGAG
TGGCTAGACGATACTATTGCCACAATACGCAGCAGCGGATCGACAGCCAACATACTCGAGCTGGGGTCCGGCAGT
GGAATGATCTTGTTCAATCTTGTCAACGGCCTGCACAGTTATGTTGGACTTGACCCGTCAGAAAAGGCCGTGGAC
TTCGTTTGTTCCACAGTTAAATCCATTCCCCAGTTGGCCGACCGTGTCTATAATATAAAGGGAACAGCAGACAAC
ATCAACAGTCTAGGCGTACCCATCTTTGCTAACATGGTCATCGTGAACTCTGTCGTCCAGTACTTTCCCAGTCAA
GACTATCTGCTCAAAGTAATTGAGGACCTAGTTCAGCTGGAAACAGTCCGCACGATCTTTTTCGGCGACATTCGC
TCCTACGCGCTGTTTCGAGAGTTCCAAGTTACCAGGGCGCTGCATATTGCAGGAGATACTGCAACCGAGGACGAG
ATCCGACAGATGATGGCCAACATGGAGCAAGTCGAGCTGGAGTTGCTGGTAGATCCCGCTTTTTTCACATCCTTA
GTCGACCGGTTCCCTGGACTCGTCGAACATGTGGAGATTCTTCCAAAAAGATTGAAGTCGACGAATGAGCTGAGT
GCCTATCGATACGCTGCCGTCGTGCATCTCAAAGACTCAAACCAACTGGCTCAGCCATTACAACTCCACGATATC
CAGAAAGAGAGCTGGATTAACTATTCCGGGCGTCAACTCAATCGTCAGTCGCTGTTACAACTTGTACAGGATTCT
TTCTTACGAGACCCGTCCCCCTCATCAGTTGTGGCTGTATGCAATATACCTTATAGCATGACAGTCTACGAGAGG
CACGTGATTGAATGGCTTGATAGTGGCCTCACTGCCGGTCCCGATGCCGAGGACTGGCTCTCTTCTATCCGCCAA
ACATCACAAGAATGCTCGTCACTCTCGGCTCTCGATCTGCAACAAATAGCTCACCAGACAGGATGGCAAGTGGAG
ATCAGCTGGAGTCGGCAATTTTCTCAGCGCGGTGGCTTGGATGCCATATTCCACCGACACCATTCACGAGGAGAC
CGAACCAGCAGGGCTTTGTTCAACTTCCCCACAGATCATCAAGGACGGCCATCTCAATCGTTGAGCAATTGGCCT
TTGCAGCGCAAGCAACAGGGAGAAGAAAAGCAAATAACTTTGGGAGATGTTTCCACCGTCTGCAAAGAGGACTTG
CATGACATCTGGACTTGGAATGAAGTTGTTCCAGACGCCCTCGAGGCCTGTGTCCACGATCTCATCTCGGACACA
GTAAGAGCTCAGCCTCAATCCCCTGCTATTTGTGCTTGGGATGGTGAGTGGAGTTACATCGAGCTTGATGATTTG
TCTAGCCGTCTTGCACACGCGCTTGCTCCGTTTGGCGTTGCTAACACAGTTGTACCTATATGCTTTGAAAAGTCA
AAATGGACACCAGTGGCAACGCTGGCTGTGATGAAGGCCGGGGCAGCGTCAGTCACCCTCGATGCCTCTCAGCCT
CTGGAAAGATTACGGTCGATTATCTCCCAGACTGACCCTCGGGTGATCTTGTCATCGGCGTCTAAGCAGGGCTTG
GGTGCCCAACTCACTAAAGCTCCAAACCTTGTTGTTGACCAACATTCCATTTCTACTATGCACATCACCGCCGAG
CCTCTTCCCACCGTTGACCCCTCCAGCAAGCTATATATTGTTTTCACATCTGGCACCACGGGTGTTCCTAAGGGC
GTTATTATCACACACTCTAACTTTAGCAGTGCCATCCGACACCAACAAAAAGCTCATGGTTTCAAATCGACATCT
CGGATTTATGACTTTGCCTCATACGCGTTTGATGTTAGCTGGTCTAACTTCATACATGCACTTACTATTGGTGCC
TGCTTGTGTATTCCGTCAGATGAGGACCGCCGTGATGACTTGGCCGGGTCGTTGGAGAGGTTCGGCGCTACCCAT
GTTGACATGACGCCTTCCGCAGCAAGCTTGCTCCCAGAGAAGTCATTCAAAAGGCTTGAGACGGTTGTACTCGGA
GGCGAGAAGCTTTCTGTCGAGAGCGCACAGCGCTGGAGCTCACTGGTCAGCCTCAAGAACCCATACGGTCCCAGT
GAATGTACGCCCACGGCTACCATTGCGACGGTAACACCCACCGATGAGTACAAATCCAGTATTGGAAGAGGACTA
GGTCTGAATACATGGATTGTGAATACTGCTACAGACTCTTTAGTTCCAGTCGGCGGAGTCGGAGAGCTCCTGCTC
GAGGGACCTCTCGTTGGCGCAGGGTACCTCGGCGATGACACAAAGACGGCCGCTTCCTTTGTGCAAGACCCTCAG
TTCCTATTGCAAATTTGCCCTCAAGGTCAAGCAAGACATACCAGAATGTATAAGACTGGCGATCTGGTTCATTAC
AACCCGGACGGAAGTCTTAGTTTCATTGGGCGCAAGGACGCTCAGGTCAAGATTCATGGTCAGCGTGTTGAGTTG
ACCGAGATTGAGAGCCACATTCGTCGCATCTCTAAGACTATCCAGGTGGCTGTTTTGTTTACCAAGTCAGGGCTG
TGTGCAAATAGGGTAGTTGCATTTGTCTGCATCCAGGGAACTGGCCAAACTCAGACAGCCGCCGATCAAATTAGA
CTCATCGATCCCAAGTATTCGACCCTTGTTACGGCTTACACCGAGTCCGCAAAGTTTAGTCTCAGCGACACTCTT
CCTGCTTATATGATTCCCTCAATTTGGATTCCACTCCAGCATGTTCCGTTGTCAACGTCCGGAAAGCTCGATTAC
AAAGCTTTGAAATCATGGCTTGATAGCATGGATGCCAAGACGTTTGCCAATATTTTAACTGCGTCTGATGGCGAC
GTGAAGCTTCGCAAGGCTGAGACAGAATTGGAACAGGTCATAGTAGAGGCTTGCGCTACAATTCTCAACATTACA
GCATCGAAGGTGAACCTGGATCGGTCGTTCATTGCGAATGGAGGTGATTCCATATCCGCCATGAGGCTCGTTGCT
CATTGTCGCGCGGACAACGTCGTATTTTCGGTGGCTAAATTGCTAAAGAGCAAAACTTTGGCCGCTTTGGCCTCA
TCTTCAGAAATCAAGTCAGCTTCCAACGTGTTGGGCTTCTATGAGGAGAAAAGTGACTCTTTTGCGTTGTCGCCG
ATCCAACAGTGGTTCTTTGAACAAGGTCTCTACAAGAGATCCAATGACAACTTCGACAATCAAGGATTTTATCTC
AAGGTTAAGCGCCCATTATTGACAAAGGATATTGACTCGGCGATTTCCAAAGTTGTTCAGCATCACTCTATGTTG
AGAGCTCGCTTTCATCGGAACGGCGACGAGTGGACCCAAAAAACGCTTAAGCCTGACACCAATGGTTTATATCAC
TTTGGTGTTCAACACACGTGCCTTCCAGCTGATATAGAGCGACTAGCTCTATCACGCCACCAGATGATCGACATC
GAAAAGGGGCCAGTATTCTCTGCTGACATTTGCCATAATGCGTTTGGAGAACAGTACCTGATCCTGATTGCTCAC
CATCTTGTTGTTGATTTAGTCTCGTGGCGTGTCATCCTGGAGGACATAGAATCTCTACTCGGTGGTAGTAATTTG
CAACCAAGTCTTCCATTTCAAGTCTGGAATGATATGCAAATTGAGCGGGCGAAGGAATCGAGCCTATTTGATCCT
GAAAATGTTCTTTCGACCACTGGAATTAATAACAAACTTGATTTCTGGCAAGCCACAGCAGAAACCAAGAACACC
GTCGAAGATCACCTAAATTTCTGTATCAAGATCGACAGCAGCATTACAGAGCTCATCCTCAAAGACGCAAATTAC
CCGTTCAACACTGAACCTGTGGACCTCCTTCTTGCGGCTGTTTGGCATGCATTCTTCAAGACGTTCCCCCAAAGA
GACGGTCTCACCATTTTTATTGAGGGACATGGTCGCGAGCCGTGGTCCTCAGATATTGATCTTTCCCGCACTGTC
GGCTGGTTTACTACCATCAGCCCCATCCATGTGTCAAAGAGCGACGTACACAAGTCTGTCGCAAGTCTAGTACGC
GTTGTCAAAGATGCGCGGCGGCTCCTGCCTGCAAATGGCTGGGCTTACTTTGCTTCTCGATATCTCAATGAATCA
GGAAAATCAGCGTTCAAATCGCACGACTCTATTATGGAAATAACCTTTAACTATCACGGCCAGTTTCAACAGCTG
GAGAACGAGAAGGGGATGTTTGAAAATATTACACTCAGTGGAGTCTGCGAGCAAGGACCAGCTCTTCCCGCCTCT
TCCTTGATTGCTGTCGAAGTCTCGATAGATCGAGGGCAGGTCACCTTCGACATTTCTGCCAACCGCTACATTAAT
CACCAGGATTGTATTTCAAACTGGATCAAAGCAATTCCACAGTCATTGGAGACCATTTCCAATGAGCTTGTGTCT
ACAGCAATCTCACATCGCACGCTTTGCGACTACGAATTTCTGAGCCTCGGGTATACGGAGCTGGATCGATTACAG
GAAAGTGTCATCCCAGAAATCGAGAAGCTAAATAATTCCACAGTAGAATACATTTACCGCTGTCTTCCCACAGTT
GATGGTATTCTGATCAGCCAGTTCAAAGACCCAGAATCGTATAAAACAGTGCAACATTTCGAGATTACTTCCCAC
AACGACGACCAAATCGACCTAGAGCATCTTTCTCTAGCATGGCAAAAAGTGGTTGCCAATCAACCTGCTCTACGA
ACCGTCTTTATCCCTGGCATGGATAAAGCTGCTGCATTCAATCAAGTTGTGCTGTCTCAGTACCACGCCGAGCTC
ATCATCCTGCGTACTGCCAGCGACGAGTACACCGAAGCCTTAGAGATGTTCAAGAATCTAACCCCAATCAATTAT
CAGAGCTTCAAGCCACCTCATAGAGTCGCGATGTGTCGAATCTCACCTAGTAGAGTACTCTGCCAGGTTGAGATG
AGTCATGCCATCACAGACGGTGCATCAACATCTATTTTGGCCAATGATCTTCTCCAGGCATACAACGGCAACATG
ATGCCAATAAATCTCATGGACACAGCATGTGAGTTTGCTCGGGCCCAACTCACTTCCTCTTTTGGGGAAAAACTA
TCATACTGGAAGAAAAAGCTTTCGGGAATGGATCCCTGCCACTTCCCCAAAATTTCGGGTGCTTCAACACAAGGC
ACCGGTACATCCGTCTGCAAAATTCGTGGCTCTCTGTTTAGCAAAATCCAGGATTACTGCAATTCAGTAGAAGTC
ACGACGGCCAGTTTATTTCAGACCATATGGGCACTTACTCTGGCCGCCTATACCGGCAACGACTCGACATGCTTT
GGGTATCTAGCATCTGGCCGCGACTTGCCTATTGCTGGCATCGATAAATCTATCGGTGCATTCACAAACATGTTG
ACTGTTCATGATCAAGTTATGCAAGATCTGGAGCACCAGCACTGCTCGCTAGCAAGCATCCAGCATGAACTAGGC
ATAAATTCCGATAACCCTCTTTTCAACTCCATCCTATCATATCAGAAGCAGGACGATGAGCCGGCAGGAGACGAG
GGTTTGGTCATCAAGGCCTTGGACGGACAGGATCCCACAGAGTACGACATTGTGTTGAATATTGGGCACGCTACC
GACCACATCGAAATTGTTTTTGACTATAAACACGCCTGTCTTTCAAGCATCCAGGCAGAGAGCGTACTTTCACTC
ATGCAATCTACAGCTGCCGCTCTAGTTCAGCATGCTTCGGGAGATCATCAGACTTTAAGAAGCGTCAACATGGCC
AGCACTGAAGATATATCTGACATATGGGAATGGAACTCAAACGTGCCAGTCACTGTCGACGATTGTGTGCATCAT
ATCATTACGCGAACTTGTCATGAACGCCCCCAAGCTCCGGCAATCTGTGCATGGGATGGCGATTGGACCTATGCA
GAAGTCAACAAGCTGTCAGATAAACTTGCCCACCTTCTAGTCTCCTATGGTGTTGGCCCTGAAGTGGTTGTCCCG
CTTTGCTTTGAAAAGTCAAAGTGGACACCCATAGCAATGATGGCTGTCATGAAGGCAGGAGGCGCATCTGTTGCC
ATGGACTCAACCCAACCAGAGGAACGCCTACGAGCAATCGTAAATCAAGTGAAGTCACCTATTATCTTGTCATCA
TTTGCCAACGAACAGCTTGCAAGCCGACTAATCAGCGAGCTTCCCAGCCCCATCAAAGTCCTCACAATAAGCGAC
AAAGAATTGGAAAATTTGAATGTTCCGAGTGGAAGCCAACTTCCTCATGTCAACCCCAGTGATACGCTCTATGTG
GTATTCACATCCGGTAGTACAGGGGTGCCAAAGGGAGTGGCAGTTACTCACTCCAACATTGCCAGTGCGATCAAA
CACCAGCGACACTCGCTTGGATTCACCTCTGAATCTAGGGTATTCGACTTTTCTTCCTATATGTTTGATGTTGTC
TGGTGCAACTTACTACAGGGTCTTTCTGCTGGAAGCTGCGTTTGCATCCCGAGCGACAATGAAAGAAAGACTGAC
TTTATGGCCGCTATTGTTAGGATGAGGGCAAACCTTGTCATATTGACACCTTCTGCTATCCGCGGCCTGAAGCTT
GACGCTCTGAACAGCCTATGCAACGTCCACTTCATCGGCGAACCTTTACATGTTGACACTTTTAGATCAGTTGAC
GAAAGTGTCACGATATCCAACCTATATGGCCCCACTGAATGTACAACATTCAGCACAATACAAACCATCTGCGGC
AGACAGGATCAGTCAATCACAATTGGCAAGGGAGCGGGTCTGAATACCTGGGTCTCGGACATAGCCACTGGTACG
GCTCTTGTACCAATTGGCAGTGCGGGAGAGCTTCTACTTGAAGGCCCATTAGTCGCCGCCGGCTACCGGGGTGAT
GCTGTCAAAACGGCTGCCGCATTCGTATATGACCCGCCATTTCTTCTGCGTGGATCGGTGGGCCACCCTGGCAGA
CGTGGCCGCCTATACAAAACCGGAGATATTGTTCGGTATAACTCCAACGGTACTTTGACTTTCCTTGGCCGAAAG
GATTCGCAAGTCAAGATCAACGGACAGCGAGTTGAATTCGGTGATATTGAGTCTCACATAAACGGGGCGCTGCTA
CCGGACTTCAGTGAAGGTCAAGCTTTAGTCGAGTTTGTAACACCGCAAGGAAGCTCACGTCCAATGCTTGTAGCT
TTTGTTTACTTCGGACCTAGTGTCACTGAGGGCATGGATGAGGCCGATCTGCTAAGCCTAGCCAAGCGCACAGCC
ATATCGCTGGATGAGAGTCTTGCTGCTCGAATCCCTGCATTCATGATACCATCCGCTTATATTCCATTGCAGAAA
ATTCCTGTCACAGCGACAGGCAAGACAGACCGCCGTCGTTTACGCGAGATGGCCAAAGATGTTACCTGGGACCAG
CTCATTTCAGCTGACTCCCACGGTCCTGATCGTTGTCAACCTGGCACAGAGATGGAGATACAGCTGCAGATCCTA
TGGGGGACTGTGCTAGGAGTTGAAAGTAGTTTGATCGGTGCACACGACAACTTCATGCGCGTCGGTGGTGATTCC
GTGGGCGCAATACGCTTAGCGAGTTCTGCCCGGGAACTTGGTTTCACGCTAAACGTGGCTGATATTCTCAAGAAC
CCGAAACTAAGTGATATGGCAAAACTTATGATACGAACAGAGCCGTCGCAGGATATTTCAATCAAGGAATTCTCT
CTCCTCAAACCTGGCTCTGATGTCGACTGGGCTGTTGCAGAAACATCCGCTTTATGTGGTGTGGACGGTAACCAA
GTCGAAGACTTGTATCCTTGCACACCCCTGCAAGAGGGCTTGCTGGCGCTGACAACAAAGCGCCCCGGCGACTAC
ATCATCCGGTGCATTTTGGAACTGAAGAGATCAACAGACGTCAAAAAGTTCTGCGCCGCTTGGGAGGCGGTGTTG
GAGAGCACCCCAATACTACGAACTCGGATCGTAGACATCGCAGAACAAGGTTTGATGCAAGCTGTCATCAAACAA
CCAGCACAGTGGACATCGGCAGAAACCTCCAGTTTGGTAGACTTCGTGGCTGCTGATAATGAGAAGACAACTGGT
CTGGGTATGCCCTTGGTGCGATTCGGACTAGTGCAAGAGACGAACAAACACTTTTTTGTTTTGACTCTGCATCAT
GCAGTATATGATGGCTGGGCGCTGAATCTGGTCTTCGAAAAGCTCGAAAATTTTTATGCTGGGTCTTCCAGGCAT
GAAAGCCCGGATTTCAGACACTTCGTCAAGCACATTTCAAGTCTCGACAACGACGCGGCTGCCAAGTTTTGGAAA
GACCAACTCCAAGGCTCAGAGGCACCCACTTTCCCCTCCTTACCAACTGCCACGTTCGTGCCCAAGTCTGAAAAG
ACCATTTTGCACACAGTTGAAGAGTTGCAGTGGCCCAAGACGAATGTCACTGCTTTTACGTTGGTGCGTGCGGCA
CTGTCACTTTTAACGGCGGCCTACACCAATTCAGAAGACGTTTGCTTTGGCGTGACTTCCAACGGTCGGCAGGTT
GGGCTCCCTGGAGTAGAAAGAATGATAGGTCCGACTATTGCGACAGTGCCAGTTCGTGTTCGCATTGACCGCGAG
CAGCGTCTCCAAGCCTTCCTCACACAGATGCAGCATCAGTCCATTGACATGATAGCGTTTGAACAATTTGGTCTG
CAGCAAATACGGAAGTCAAGTCCTGACGCCGAACGGGCCTGTAACTTCCAGTCACTTCTCATTGTCCAGCCGGCA
GAAGAGACAGCCCAGTGGCAGAGCGATATAATTGCCCGTGATATCGGAGAAGGAGCTGATGATCCTATGGGCATT
CAAGAAATTGGAACATATGCCCTTACTCTCGAATGCCATCTCGGACCCGACAGTTTGCTCATAAAGGCCAACTTT
GATTCCAATGTAATCGATGAACTACAGGTCAAGCGATTTACAAAGCAGTTTGAGCACGTGCTACGTCAAATATGC
TGCTCTGGTAGTGGCCTTGTCGTTTCTGATATTGATACCACCAGCAGACAAGACATGGAAGATATTTGGAAGTGG
AATGCCGTAGTCCCCCAGTCAGTCAACACGCCTGTTCATGAGCTCATCTCCTCTGTGGCACGCAGACTGCCGCAT
GTCCAAGCTGTATGCGCATGGGACGGCAACTGGACTTACCGTCAACTGGATGACCTGTCAAATTATGTTGCGCAC
CACCTCGTCGGCCTTGGTGTTGGCTCTCAGGACATCGTACCGCTGTTGTTCGAGAAGTCCAAGTGGATGCCGATC
GCGATGCTTGGTGTCATGAAAGCAGGGGCTGCATCGGTGGCTGTCGATACCAGTCAGCCCAAAGACCGACTTCGC
ATGATTATCGACCAGGCAAATCCCACGGTCGCGCTAAGCTCAGCTGATAAGTTGCCTCTTGTCCGGAGTCTGACA
AAGGCGCAAAGCTTCGTTGTCAATGGCCAAGCTATTGACTGCTTATTAAAACCTAGCCTTAATGCTACACTTCCA
GTTGTCGATCCGTCCAGCAGACTGTATTTGGTCTTCACCTCTGGTAGTACGGGTGTCCCGAAGGGTGTTATAATT
CGACATTGCAATTTTGCCAGTGCAATTAAACACCAGAAAGAAGTTCAAGGCATCCTTCCAACCTCGCGTGTCTAT
GACTTTGCTTCATATGCATTTGACGTCGCATGGGCCAATGCGCTACTGACCTTTGAGAGCGGCGCTTGTCTCTGT
ATCCCATCCGATGCTGAGAGAAAGAATGATCTAAACGGTTCGATTGCGCGACTGAAGCCAACTCACGCTGATCTT
ACGCCTTCGGCAGCACTAGTCCTGTCCAAAGAGTCACTTCAGCAGCTTGATACCCTCACTTTAGGTGGCGAACGT
CTCCTAGCGGAGTACGCAACAAAGTGGTCCCAGTTTGTGACAGTTAAAAACTCATACGGACCAAGCGAGTGCACT
CCAACTGCCACATTTACCGAGGCAATTGGGCGTGGATACGATCTTGGTGCTAGCATTGGTAAGCCTGCTGGTCTC
AACACTTGGGTGGTTGATCCTGTGACGGGGCAGTCGCTCGTTCCCATTGGAGGCGTCGGCGAGCTGTTCTTGGAG
GGGCCGCTTGTCGGTGCTGGCTATCTTAATGATGCAGAGAAAACGAATGCTGCTTTTATCCATGATCCACCATTT
TTGCTCCGCGGCAACGTTGTCGCGCAACCTGGACGACGCGGCACGCTGTACAAGACGGGTGACATTGTGCGATAC
AACTCAGATGGCAGTCTCACTTTTGTTTGTCGGAAAGATACACAAGTCAAGATCAATGGCCAGAGAGTAGAGCTT
GCTGAGATTGAGAGTCATATAGCTCTATACACAGCGACCCGACAAGTGGCGACCCTATTGCCTAGCACTGGCCTC
TGTGCAAACAAGCTGGTAGCTATGATCAGCCTCACAGATGTGAACTATGATGTTAGCGAGGACCTCGCCGAAAAC
AAGATTGAGCTGGCATCTTCGGAACATGACCAACTCATCAATGAGCACATCGAGGCCCTTCAATCGTTATTGCGC
GAGTCTTTGCCGCAGTACATGATTCCATCTCTGTGGGTGGTCTTGTACAACCTCCCTATGACAGCATCGGGAAAG
CAAGACAATAAGGCACTCAAATCCTGGCTGGAAAATATGGATGAAACGCTCTTTTCTAAAATCAACAATGCGAAC
GGTAGCGACATTATCCGAAAACCAGACACAGAAGACGAAAGAGCTCTCATCCAGAAATGCAGTATCGTCCTTAAT
ATGCCCGTCGACAAGATCAATCTCGACAAATCTTTTATTGCGAATGGTGGAGATTCCATTTCCGCCATGAGGCTT
GCATCCCACTACAGAACTGCGGGAATTTCCATCTCAGTCTCAACACTCCTTCAAAGTAAAACCCTCGCGGATTTC
GCAGCATTTTCGGGCGCAACAGCCATTACCGGAGTCAGTCAGGAAGAGCATACTGACGTTCCTTTCGAACTATCA
CCCATCCAGCAGTGGTTCTTTGACCAATCGCCATTTATGAGCCAGCAGAAGCATGACAGATTCTACAACCAAGGA
TTCTATGTGAGACTCAGGCGCACAGTGGGAATCAATGATCTAGAATCAGCCTTTCTTTCTCTGGTCAATCGGCAC
GCGATGTTACGCTCGCGATTCCAGCATCATGGGGGCAAATGGAAGCAAATAATCCCCAGTCACGGCAAACGAGCT
CTTCATTTGAACGTATCGCAGCACCTGTCCATGAGCGAGATTGCATTGTTAGCTCAAGAGCGGCACCGACAGATT
GACATAGAGCAAGGTCCTGTCTTCTCGGTTGATATTTGCTTACTAGGCCAGCAGCAGCATCTGGTCATGATAGCC
CATCATTTGGTTACCGATTTGGTCTCCTGGCGGATTATCTTAGATGATCTGGAGACTATTCTCAACGGCCATTCC
CTAACGGCCGCTCTATCCTTCCAAGTGTGGAGCAGGCTGCAAGCTGAGCGGGCTGTATCTTCCACTTTGAAGCCT
CACAACTTGCTGTCGACTGACGGCGTCCATAACAATCTCAAGTTTTGGAAGTATACGCACGACACGCCCAACTGC
TTGGCAGACCACAGGCTCCGATCGGTCACCATTGATCGAGAAACTACGGCTGTACTACTGGGCGAGGCAAACAAA
GCCATGAATACAGAGCCAGTAGAGATCCTTTTATCAGCTGTTTGGGATGCATTCTTTCGGACGTTTTCCCAGCGC
AACAGCCTGACCATATTCAACGAAGGTCATGGTCGCGAAGCTTGGTCCGATGAAATTGACTTGTCGAGCACTGTT
GGATGGTTTACCACCCTCAGTCCCATCAACATCTATAGAAATAATGCCACCAGCGAGACCGACATGGTGCGGCTC
GTCAAGGATGCCCGCCGCAGCCTTCCCGCGAACGGCTGGTCTTACTTTACCTCCCGATATCTGAACCCCGACGGG
CAAAGAGCTTTTGAAAGCCATAACACAGTGTCTGAAGTTGTTTTCAATTATCATGGCCAATTCCAACAACTAGAA
AGTCATCAAGCCCTTTTTGAAGACATTGATCTTGTCGGTGTACGTGAGCAAGGTCGCTCAATATCTGCAGGGTCT
TTGTTTAACATCGAGGTTGCCATTGAAGCAATGCAAGCGCACTTTGAATTCTCCGTTAATCAAAATATCGCTCAT
CAGAGCTTGATTAACCAGTGGATTGACCAGATTCAACCCTCTTTGGAAAGGATTTGCCTCGTCCTTCTCGAGGCC
AACCCAACGCATACGCTGTGTGACTTCAAGTTCATCAGTCTCGACTACCAGCGCCTTGACGATCTTACCAGTCGG
CTACTTCCGGAGATCGAGTCAATCAACCAATCAACTGTTGAGGAGATTTTCTCGTGCTCTCCGATTGTCGATGGA
ATGCTCCTCAGTCAGATAAAGCAGCCCGAATCATACAAGACACTTCAGCGATACGAGGTGTTGTCATCTCATGAC
CATCCTATCTGTCTCGACACCCTCAAAATTGCTTGGCAAAAGGTGATTTCTCGCCAGCCTGCCCTGAGGACAGTT
TTCATCGCTGGCCTTGACGGATCTACCGCCTTTTACCAGGCCCTTCTCAAAGAGTGCTCCGGGGATGTTATCGTT
GTTGAGGCTAAAACTGAAGAGGAAGCCCTGAAAGCCTTTTCCTCGCTTCCGAAAGTCGATTACCAACAGGCCAAA
CCTCCTCATCGCCTCACTCTTTGTCAAACGCCGGATGACAAAGTCTTTTGTCAGATTGAAATGAGCCATACTATT
ACTGATGGTGCCTCTTCCAACATTTTGATTAAGGATCTGATTGACGCTTATGGTGATAGGCTGTCGTCAACAGAC
CTTGACAAAACAACACGCGAATTTGCTAGCCACTTGCTGGCTAAGCCACAGTCCCAAAAGATTTCGTATTGGAAC
ACAAAACTCAAGGGCCTTGAACCTTGCCGCTTTCCATCCCTATCGAGCATGTCTCGGGAGAAGCACGAGTGTAGC
TCGGAGATTGGAGTTTTTGTCGAAGACAAGATGTTTGCGCAGATTCAAGACTTCTGTAGCATAAACCAGGTCACG
CCAGCAAGTCTCCTCAAAAGCGCCTGGGCTTTGACACTCTCGACCTACGTACAAAATCAATCTGTCTGCTTTGGC
TATCTGGCATCTGGTCGAGACCTCCCAATCGCCGGGATGGACGAATCTGTCGGCGCTTACACTAATATCATGGTC
TGCCGTGCCGATTTGGATGGGCAACAGCCTGGTGTGGCACTCGTGCGACAACTTCAGGATCAATTAATGCAGGAC
TTGAGCTTCCAACATATATCGCTTGCTAGCATTCAACATGAGCTTGGACTGGCGTCCGATCAGCAGCTTTTCAAC
TCTATTGTCTCTTTTCAGAGGTCAGGAGACGATAATGAACAATCAGCAGAGGAGGGTAAACTTCGATTCAAGAAT
ATTGATGGTTTGGACCCAACAGAATACGACATCGTATTGGGTATCAACCAAGGAACCAGGTCCATCGAAATTGAC
CTTGAATTCTCACACAGCTGTCTCACTAGTAATCAGGCAAAACGCATTCTCGAGCATCTGGAGTCAAACATTGCC
GCTATTCTTCACAATGAGCCACCTGCTCTGATCAGCCCCCAAGATGAGCAAGATATTTGGAGCTGGAACTCCACT
GTTCCTGACATGGTCAACATCTGCGTTCACGATCTGATCTCCAAGATAGTATTCCGCCAGCCTGATGCACCAGCT
GTTTGCTCATGGGACGGCGATTTCACCTATGCGGAGCTGGATAATTTTGCAACACGCCTTGCCAATAGTCTCAGC
AAGATGGGCATCGGAAGAGGCAGCATCGTCCCGCTATGTTTTGAAAAATCAAAATGGACACCAGTTGCCATGCTA
GCAGTTATGAAAACAGGTGCAGCCTCTGTTACGATGGATACTAGCCAGCCTGAAGAACGGCTCCAGTCTATTGTT
GCACAGGTGGATGCTAAACTTGTGATCTCTTCGACATTGAAGGTTGAGCTAGCAGCCAGGCTCACAACGGCTCCC
GTCTTGGCTATAGACAAAGCCAGCATGAAGGCGATGGCTGATGATACGCCGCTGGCTGCAGTCGATCCCGCAAAC
AGTATTTACATTGTCTTCACATCAGGGAGCACTGGCACGCCAAAAGGTGTCATCATCACTCATACTAACTACAGC
AGCGCCATCAAGCATCAGCAGAGTGAACACGGCTTCAAGCCATCCTCTAGGGTCTTTGACTTTGCCTCTTATGCG
TTCGATGTCAGCTGGTCCAATTTCTTGCACACCTTGACCATTGGGGCCTGCTTATGCATACCTTCTGATGATGAT
CGTAAAAATGACCCGGCGGGCGCAATTGACCGCTTACGGTGTACACACGTTGATATGACCCCCTCGGCCGCAAGC
GTCTTACCTGCCAGTACGTTGGCTAAATTGGATACCATTGTTCTGGGAGGCGAGAAGCTGTCGCTTGAATATGCC
CAACGCTGGTCCGCCCTGACAAGCGTGCGTAATCCGTACGGGCCTTCTGAATGCACACCGACGTCGACAATTACG
GAGATCAATTCTGCGGAAATAAGCAAGGGCAAAGTGAGCATCGGCAAAGGAGTGGGACTCAATACTTGGATTGTT
GATCCTGCCACTGCACAACATTTAATGCCGATTGGCATCCCTGGGGAGTTATTACTCGAAGGTCCGCTTGTTGGT
GCTGGCTATCTTGGAGACCCTGTCAAAACCGCTTCAGCATTTATTGAAGACCCAGAATTCCTAGTCAAAGGCGCT
GGTCCAGGAATTCCAGGCCGCCGTGGTCGTCTGTACAGGACGGGCGATCTAGTCACCTATAATACCGATGGTAGC
TTGTCATTTGTGGGCCGAAGGGACTCTCAAATCAAAATAAACGGGCAACGCGTCGAATTAGGCGACATCGAGTCG
CACGTTTCTGCAAACCTGGTGAGTCATGGCAGTGCTCAGGTTGCGGTCGAGGTTGTGTCACCCCAAGCTAGCTCC
AACAACATACTTGTCGCCTTCGTGAGCTTTGACGACCTGAATTATATCAACCTGAATGATGAAAAGCTTCTTGCC
CGCACGAAAGCGGCGACCGAGGGAATTAGGGAGAAACTCGCGACACAAATCCCATCTTATATGATTCCTTCGGTC
TACATCCCTGTTACTGTTTTTCCGACAACAGCTACTGGGAAGACTGATCGGCGCCGATTACGTGAAATGGCCTCA
AGCCTCACCCTGGAGCAGCTTACCTCAATCAACCAAGCTCAACAGCAATATCAACCCCCCACTACTCCTTTGGAA
GTGGCACTTCGGGAGCTCTGGATCTCAGTTCTCAAATTAGGATCGCGAAAGATTAGCACTACAAACAACTTCTTC
GAACTTGGTGGAGATTCCATCGGTGCTATGAGGCTGGTAGGCGCGGCCCGTGACCACGGACTATCGCTTTCCGTT
GTAGATATTTTCAAGCATCCTAAGTTCAGCGAAATGGCTGCTTTGCTCCGTTCTGTGGATAAGCCGCAGTCGGAA
GAGCCACGGGTATTTCAACCCACTTCGCTTCTGTCCAAAGATCACAACAAAGACCAGATACTCTCTCGACTCTCT
GACTTTGGTATTGACTGGGAAAATGTTGAAGACATCCTCCCTGTCACAGATCATCAAGCTCGTTCCATCGCGATG
ACTCACTCTGCGTCCCGCGACTTGCTACTCTATCACACTTTAGATAGCAAGGGCGTGCCAAATATGCGCAAGATG
CGAGCAGTGTGCAATGAGCTCGTCAATAGATATGATCTCTTGCGAACCCTTTTCATCGCACATAAAGACAGCTTC
TTGCAGGTCGTGCTGAAGGCCTTTCCTGTGGATATAACCGTCTTGAGAATCGAGAATGCCAGCCTAGAAGAATGC
ACAGAAGAGCTACGATTACGCGACAGGGACGATGAGCTCCGTTATGGCTCGCTCCTAACAAAGATTGCTATTTTG
CATCAAATTCGCGACAACGAATACCGTCTTGTGGTCCGCATTTCCCATGCTCAACATGACGGAATGAGCTTGATG
AAAATGTGGAACGCATTTGAAGAAATGTACGGTGACGGGAGTGACGACTCATTCCACATTCCTTCGGACACTAGC
TTCCAAGAAAAGTCCAAGGCTAGTTTCTCCAACTACATGCATGCCGTGGCTGGTACAAACCGGGAGCAAGCTAAG
TCTCACTGGCGCAGACTCCTCAAGGGCTCCAGTATGACGAACCTCAAGCCCCATGCTTCATATGCCCTGACCTTT
GGCGAAGGACCATGTGTCGCCAGACATGTTCCTAAGAGCATTGCTCAAGGTACTGGATTTACATTTCCTACTGTA
CTGAAGGCTGCTTGGGCGTACGTTCTGGCAAAACACCTTGCCAAAGACGACGTGGTTTTCTGTAACCTCACTCAC
GGTCGGGGCTTGCCCGGGACACAAGATGTCTTTGGAGACTGCGTGAACATCATTCCTACTCGAGTATCCTTTACC
GACGGATGGACTGTTCGCGACCTTCTCAGTGCATTGAACACGCAACAGATTGCGAGCATGGAGCATGAGAATATA
GGCACACGCGAAATTGTCCGTGACTGTACTACATGGCCGAAGTGGACATATGCAGGATCCATCGTTTATCACCAT
GACTTTGACGATGGAGAACATATTGCTCATAACCGCAGTATGCACGTTGAGCAGGAGCTAGATCTGTCTCACGGC
AAAGTGGACATGACCGACGTTCATATCACTTCTAAGCCTGATAACAACATGTTCCGAATTGAGCTGGACTTCGCA
CATGGCGTAATATCTGAGCGTGACGCTGAACTGCTGGCTGCGAAACTGACGGAATCTATCATCGTTTTCTGCAAT
GTCATGGACCAGCCTTTGTTATCTCCCGACCAGATCAGATATCTGCGGACAACCACATTGCTGCCCTCAGAGGAG
CCTCTCAGTGCAACCCCAACAAATGAACAGTTAATGGTTGCTAGCATTAGCCCGACTGAAATGCAATGGGCGCTT
GAGAGTGCGTGGAGGGACACTTTCAATTGCCGCCTTAGTCCTGAGGTGAAAGCGGGCAAGACAATTTTTGATCTT
GGTGGTGACTTGGTAAGCGCTAGTCTGATATCAGCTCACATGGAGAGGCAAGGATATGTTCTTAGTGTTGAGGAT
GTCTTGGGGAATCCGACTTGGTTCTTGCAACTGACGCTGCTGACGAAGCGCTCCCTTCGGGATGTTGATGTCTGA
Transcript >Ani_SJS100_1|g9357.t1
ATGCGATCTCCCAATGATCTTACAACATCAGCAACCATGGAAGATATTCATCAAATATGGTCTTGGAACGCTAAC
GTGCCTGAGGCGGGTGAGACATGCGTTCACACCCTCATCACCGACAAAGCTCTCCAGCAGCCAGATGCACTTGCC
GTCGACGCTTGGGACGGGAGGTGGACGTATGGTGAGCTTGAGAATACTTCTACCAAACTGGCATTGCGTTTGCTT
GACTCTGGAGTTGGCCCTGGAACCAATGTTGTCATATGTTTTGAAAAGTCGAAGTATACGCCTCTGGCTATGCTG
GCCGTCATGAAGGCGGGTGGAGCCTCCATTGCACTCGATACAAGCCAGCCACAGACTCGATTACAGTCTATCATC
AACCAGGTCGACCCTGTAGTGATACTATGCTCCGCGTCCAAGAGCCAGTTGGCCAAGTCAATTATCGCCGAGTCT
GCAGTAGCATTGACAATTGATGAAAATTCTCTATCCGAAATGCATTTCGAGGCGGACTCAGTCGCCCGTCTCCCT
GACGTCAGTCTGGACAACAATCTCTACGTGGTCTTTACCTCCGGAAGTACAGGAACTCCCAAGGGAGTCGTCGTC
ACACATCTCAATTATTCTACTGCCATTCTCCACCAACAAGAAGCGCATGGATTCAAGTCCACTTCAAGAGTGTAT
GACTTTGCTTCGTATGCTTTTGATGTGAGTTGGTCAAATCTCATCCACACCCTCACCATCGGCGCCTGCCTGTGT
ATTCCATCAGAGCAGGACCGTAAGGACAATCTCATCGAGTCCATACGCTCACTGTGTGCTACACATATCGATGTG
ACCCCGTCTGTTGCTCGCCTTCTCCCTGATACCTTGCTCTGCAAGATTGAAACACTTGTTTTAGGTGGCGAAAAG
CTGTCTGCAGAGCTTGCCAGACATTTATCATCGCTAGTAACATTGAAAAATCCGTATGGACCGAGTGAATGTACG
CCTACATCAACTATCGCTACAATTCGACCGGATGATGATGATTCAAAAATTAGCAGCATTGGCCGAGGCTTGGGT
GTCAACACCTGGGTTGTAGACAGTGAGAATGAAGGAATTTTGGTGCCTATTGGACAGGTTGGAGAGCTATTACTT
GAAGGGCATCTGCTTGGCAATGGCTACTTGAACGACCAGACGAAGACCACTGCAGCCTTTGTCAACGATCCGCTT
TTTCTGCTCAATGGCGGCGATGGACCTGGGCAGCCTGGGAGGCACGGGCGTCTCTACAAGACCGGCGACCTGGTC
CGTTACGAGAAAGACGGTAGCTTGACATTTATTGGCCGTAAGGACACGCAAGTCAAGATTAACGGCCAACGAGTT
GAGCTGGGTGATATTGAGCATCATATTAACCGCCACATCCCACATGGTACCGTGTCTGTGCGACAAATTGCAGCA
GAAATTATTTCACCAAAGAGGGGTTCCAATGCTGTCCTGGCAGCATTCCTCGAGGTCGACCTTGGTGTAGAGGAT
ACGGGAATAGCGGAACAGTTGTTTTCAAAAACAGAGAAGATGATGTCTAACTTGAGAAGCAATCTTGCTCGAGAT
GTCCCTTCATATATGGTTCCTGCTGTATTCATTCCGTTGAGGAACTTCCCATTGTCTCCGACAGGCAAGACAGAC
CGACGCCAACTGCGGGCCATTGGTGAATCAATGGACTTGACTGTCTTGGCAGGCTTTGGCGCAGCACCTAATGAG
GCTCGGATCCCTCTCACTCTGCGAGAGAAACAGTTGAGAAGACTCTGGGGCTCTATCCTCAGGATTGACGAAAAC
CTTATTGCTCTCGACGATAACTTTTTGCAAAGAGCCAGCAACCCAAATGCAGCCTTGAAACTCGTCACTGCAGCT
CGAAGAGAAGGCTTCTCCCTGAGCGTGGCCAACGTGCTGAAGTATCCGCGACTTCAGGACATGGCACATGTGGTT
GAAACAGTGGAGCAAGAGCAGGCACCTGAAATTATGCCATTTGAGCTTCTGAGCAATGATATTAATCTTGATCTA
GCCCTCAGAGAGGCTGCAGCATCGTGCAACGTACAAGGGAATCAAATTCAAGACATTTATCCCTGCACACCGCTA
CAGGAAGGCATGATGTCCCTATCCGCAAAACGCGAGGGTGATTACATTATGCAGTATACGCTGGGGCTACACCAT
CGATGCGACATAGAGCGCCTAGGTAAAGCCTGGGCAACAGTAGTTGCTACGACGCCCATTTTGAGAACACGAATT
GTCGACATCACTAGCCAGGGGTTGGTACAGGCTGTTCTAAACGAGCAGTGGTCAAGTTCGTCGATCCAAAGGAGG
ACTTTGAGCCAGGCGAGAGACCACAAGCATCAATTCGGGCTAGGCATGCCACTAGGCAGATTTGAAATTGTCACC
GGCGACTCGTCTGATTCTAAGCACTACTTCGTCTGGACACTGCACCATGCCCTGTATGACGGGTGGTCACTTCAG
CTTTTACTCGAAAAGCTCGAGAACGAGTACGCCGGAAAGGCAGACGCGCAGTCAAACTCACCCGATTTTAAACGT
TTTATCAGGTATATTTCAACGAGGGATGGCGAGAAGACTCATTCATTCTGGACCGAACAGTTCCAAGACGTCGAA
GCCCAGATCTTTCCGAGTTTGCCATCTGTCGACTACCAGCCTAGATCGGACAAACTGTACACTCATTCTTTGGAA
GGAATACAATGGCCGAAAAATGGAATCACCCCATCGACGACAATCCGTGCGGCTTACTCTATCTTGATAGCCAGT
CTGACCAACAGCCCAGATGTTGTCTTCGGCAACATAACGACGGGCAGACAAGCCGCCGTGGATGAGGTTGAAGAC
CTTATTGCACCAACTATAGCCACTGTACCTGTGCGCGTTTCGATCGACAGCAAAGACGAGTTGGGACAGTTCTTA
CAGCGAATTCAATCTCAGGCCGCAGATATGATTGAGTTTGAGCAGACTGGGCTGCATCAGATTCGACATATCAAT
GCAGACGCGGAGCGAGCATGCCAGTTTCAGACACTGCTTGTTGTTCAGCCCGCGGAGGGCTCGGCCACAGCACCG
AGCAACATTTTTACCAACATTGCCGACGACATAAGGAAAGGAGATGGAAACAGCGCCGCAGAGCTGGGGACTTAC
GCCTTGACTATGGAGTGTCTGCTCAGGAAAGATGGCCTTGACCTCCATATGAACTATTGTTCCGCAGTCATATCG
GAGCATCAAGTGCGCCGTTTGTCACAGCAGTTTGAGCATGTCCTTGGTCAAATATGTCATCTGACGATGATAATT
CACAGACAGAAAACAACACTTGAATCGCTGCGGCAGCCAACAACGGAAACTGAGCGGCAGATGCAGCGAATCTGG
GCACAGGTACTCAACCTTAATCAAGCATCAATTGGGCTAGATTACAGCTTTTTCCAACTCGGCGGCGACTCTATT
GCTGCCATGGAAGTTGTGACAGAAGCTCGTAAGCTTGGCTTGAAACTGGCTGTGTCAGACATATTCCATCGCCCG
AAATTGCAAGACGTTGCAAAGAAGGCTTGTGACAGTGGCCTGCAGGTTTATGGAGAAGACCAGCTCATGAACGAC
TCGGAAGTCCAAGTTAATGGAGGCACCGAGCACACTAAGCTACCCGATGATGACAAGGCAGTCGCTGGCCATGAA
ACGCAGCAAGTCATGGTATGGGAGGGAATGTTCGATAAGGAGGTCTATGGAACTATTGATAATGTCCAATTGGAG
AAGATTGGGCGCGACTTCATCGGATGGACGTCCATGTACAATGGCAACCAAATGGACAATGTCGAATTGAACGAG
TGGCTAGACGATACTATTGCCACAATACGCAGCAGCGGATCGACAGCCAACATACTCGAGCTGGGGTCCGGCAGT
GGAATGATCTTGTTCAATCTTGTCAACGGCCTGCACAGTTATGTTGGACTTGACCCGTCAGAAAAGGCCGTGGAC
TTCGTTTGTTCCACAGTTAAATCCATTCCCCAGTTGGCCGACCGTGTCTATAATATAAAGGGAACAGCAGACAAC
ATCAACAGTCTAGGCGTACCCATCTTTGCTAACATGGTCATCGTGAACTCTGTCGTCCAGTACTTTCCCAGTCAA
GACTATCTGCTCAAAGTAATTGAGGACCTAGTTCAGCTGGAAACAGTCCGCACGATCTTTTTCGGCGACATTCGC
TCCTACGCGCTGTTTCGAGAGTTCCAAGTTACCAGGGCGCTGCATATTGCAGGAGATACTGCAACCGAGGACGAG
ATCCGACAGATGATGGCCAACATGGAGCAAGTCGAGCTGGAGTTGCTGGTAGATCCCGCTTTTTTCACATCCTTA
GTCGACCGGTTCCCTGGACTCGTCGAACATGTGGAGATTCTTCCAAAAAGATTGAAGTCGACGAATGAGCTGAGT
GCCTATCGATACGCTGCCGTCGTGCATCTCAAAGACTCAAACCAACTGGCTCAGCCATTACAACTCCACGATATC
CAGAAAGAGAGCTGGATTAACTATTCCGGGCGTCAACTCAATCGTCAGTCGCTGTTACAACTTGTACAGGATTCT
TTCTTACGAGACCCGTCCCCCTCATCAGTTGTGGCTGTATGCAATATACCTTATAGCATGACAGTCTACGAGAGG
CACGTGATTGAATGGCTTGATAGTGGCCTCACTGCCGGTCCCGATGCCGAGGACTGGCTCTCTTCTATCCGCCAA
ACATCACAAGAATGCTCGTCACTCTCGGCTCTCGATCTGCAACAAATAGCTCACCAGACAGGATGGCAAGTGGAG
ATCAGCTGGAGTCGGCAATTTTCTCAGCGCGGTGGCTTGGATGCCATATTCCACCGACACCATTCACGAGGAGAC
CGAACCAGCAGGGCTTTGTTCAACTTCCCCACAGATCATCAAGGACGGCCATCTCAATCGTTGAGCAATTGGCCT
TTGCAGCGCAAGCAACAGGGAGAAGAAAAGCAAATAACTTTGGGAGATGTTTCCACCGTCTGCAAAGAGGACTTG
CATGACATCTGGACTTGGAATGAAGTTGTTCCAGACGCCCTCGAGGCCTGTGTCCACGATCTCATCTCGGACACA
GTAAGAGCTCAGCCTCAATCCCCTGCTATTTGTGCTTGGGATGGTGAGTGGAGTTACATCGAGCTTGATGATTTG
TCTAGCCGTCTTGCACACGCGCTTGCTCCGTTTGGCGTTGCTAACACAGTTGTACCTATATGCTTTGAAAAGTCA
AAATGGACACCAGTGGCAACGCTGGCTGTGATGAAGGCCGGGGCAGCGTCAGTCACCCTCGATGCCTCTCAGCCT
CTGGAAAGATTACGGTCGATTATCTCCCAGACTGACCCTCGGGTGATCTTGTCATCGGCGTCTAAGCAGGGCTTG
GGTGCCCAACTCACTAAAGCTCCAAACCTTGTTGTTGACCAACATTCCATTTCTACTATGCACATCACCGCCGAG
CCTCTTCCCACCGTTGACCCCTCCAGCAAGCTATATATTGTTTTCACATCTGGCACCACGGGTGTTCCTAAGGGC
GTTATTATCACACACTCTAACTTTAGCAGTGCCATCCGACACCAACAAAAAGCTCATGGTTTCAAATCGACATCT
CGGATTTATGACTTTGCCTCATACGCGTTTGATGTTAGCTGGTCTAACTTCATACATGCACTTACTATTGGTGCC
TGCTTGTGTATTCCGTCAGATGAGGACCGCCGTGATGACTTGGCCGGGTCGTTGGAGAGGTTCGGCGCTACCCAT
GTTGACATGACGCCTTCCGCAGCAAGCTTGCTCCCAGAGAAGTCATTCAAAAGGCTTGAGACGGTTGTACTCGGA
GGCGAGAAGCTTTCTGTCGAGAGCGCACAGCGCTGGAGCTCACTGGTCAGCCTCAAGAACCCATACGGTCCCAGT
GAATGTACGCCCACGGCTACCATTGCGACGGTAACACCCACCGATGAGTACAAATCCAGTATTGGAAGAGGACTA
GGTCTGAATACATGGATTGTGAATACTGCTACAGACTCTTTAGTTCCAGTCGGCGGAGTCGGAGAGCTCCTGCTC
GAGGGACCTCTCGTTGGCGCAGGGTACCTCGGCGATGACACAAAGACGGCCGCTTCCTTTGTGCAAGACCCTCAG
TTCCTATTGCAAATTTGCCCTCAAGGTCAAGCAAGACATACCAGAATGTATAAGACTGGCGATCTGGTTCATTAC
AACCCGGACGGAAGTCTTAGTTTCATTGGGCGCAAGGACGCTCAGGTCAAGATTCATGGTCAGCGTGTTGAGTTG
ACCGAGATTGAGAGCCACATTCGTCGCATCTCTAAGACTATCCAGGTGGCTGTTTTGTTTACCAAGTCAGGGCTG
TGTGCAAATAGGGTAGTTGCATTTGTCTGCATCCAGGGAACTGGCCAAACTCAGACAGCCGCCGATCAAATTAGA
CTCATCGATCCCAAGTATTCGACCCTTGTTACGGCTTACACCGAGTCCGCAAAGTTTAGTCTCAGCGACACTCTT
CCTGCTTATATGATTCCCTCAATTTGGATTCCACTCCAGCATGTTCCGTTGTCAACGTCCGGAAAGCTCGATTAC
AAAGCTTTGAAATCATGGCTTGATAGCATGGATGCCAAGACGTTTGCCAATATTTTAACTGCGTCTGATGGCGAC
GTGAAGCTTCGCAAGGCTGAGACAGAATTGGAACAGGTCATAGTAGAGGCTTGCGCTACAATTCTCAACATTACA
GCATCGAAGGTGAACCTGGATCGGTCGTTCATTGCGAATGGAGGTGATTCCATATCCGCCATGAGGCTCGTTGCT
CATTGTCGCGCGGACAACGTCGTATTTTCGGTGGCTAAATTGCTAAAGAGCAAAACTTTGGCCGCTTTGGCCTCA
TCTTCAGAAATCAAGTCAGCTTCCAACGTGTTGGGCTTCTATGAGGAGAAAAGTGACTCTTTTGCGTTGTCGCCG
ATCCAACAGTGGTTCTTTGAACAAGGTCTCTACAAGAGATCCAATGACAACTTCGACAATCAAGGATTTTATCTC
AAGGTTAAGCGCCCATTATTGACAAAGGATATTGACTCGGCGATTTCCAAAGTTGTTCAGCATCACTCTATGTTG
AGAGCTCGCTTTCATCGGAACGGCGACGAGTGGACCCAAAAAACGCTTAAGCCTGACACCAATGGTTTATATCAC
TTTGGTGTTCAACACACGTGCCTTCCAGCTGATATAGAGCGACTAGCTCTATCACGCCACCAGATGATCGACATC
GAAAAGGGGCCAGTATTCTCTGCTGACATTTGCCATAATGCGTTTGGAGAACAGTACCTGATCCTGATTGCTCAC
CATCTTGTTGTTGATTTAGTCTCGTGGCGTGTCATCCTGGAGGACATAGAATCTCTACTCGGTGGTAGTAATTTG
CAACCAAGTCTTCCATTTCAAGTCTGGAATGATATGCAAATTGAGCGGGCGAAGGAATCGAGCCTATTTGATCCT
GAAAATGTTCTTTCGACCACTGGAATTAATAACAAACTTGATTTCTGGCAAGCCACAGCAGAAACCAAGAACACC
GTCGAAGATCACCTAAATTTCTGTATCAAGATCGACAGCAGCATTACAGAGCTCATCCTCAAAGACGCAAATTAC
CCGTTCAACACTGAACCTGTGGACCTCCTTCTTGCGGCTGTTTGGCATGCATTCTTCAAGACGTTCCCCCAAAGA
GACGGTCTCACCATTTTTATTGAGGGACATGGTCGCGAGCCGTGGTCCTCAGATATTGATCTTTCCCGCACTGTC
GGCTGGTTTACTACCATCAGCCCCATCCATGTGTCAAAGAGCGACGTACACAAGTCTGTCGCAAGTCTAGTACGC
GTTGTCAAAGATGCGCGGCGGCTCCTGCCTGCAAATGGCTGGGCTTACTTTGCTTCTCGATATCTCAATGAATCA
GGAAAATCAGCGTTCAAATCGCACGACTCTATTATGGAAATAACCTTTAACTATCACGGCCAGTTTCAACAGCTG
GAGAACGAGAAGGGGATGTTTGAAAATATTACACTCAGTGGAGTCTGCGAGCAAGGACCAGCTCTTCCCGCCTCT
TCCTTGATTGCTGTCGAAGTCTCGATAGATCGAGGGCAGGTCACCTTCGACATTTCTGCCAACCGCTACATTAAT
CACCAGGATTGTATTTCAAACTGGATCAAAGCAATTCCACAGTCATTGGAGACCATTTCCAATGAGCTTGTGTCT
ACAGCAATCTCACATCGCACGCTTTGCGACTACGAATTTCTGAGCCTCGGGTATACGGAGCTGGATCGATTACAG
GAAAGTGTCATCCCAGAAATCGAGAAGCTAAATAATTCCACAGTAGAATACATTTACCGCTGTCTTCCCACAGTT
GATGGTATTCTGATCAGCCAGTTCAAAGACCCAGAATCGTATAAAACAGTGCAACATTTCGAGATTACTTCCCAC
AACGACGACCAAATCGACCTAGAGCATCTTTCTCTAGCATGGCAAAAAGTGGTTGCCAATCAACCTGCTCTACGA
ACCGTCTTTATCCCTGGCATGGATAAAGCTGCTGCATTCAATCAAGTTGTGCTGTCTCAGTACCACGCCGAGCTC
ATCATCCTGCGTACTGCCAGCGACGAGTACACCGAAGCCTTAGAGATGTTCAAGAATCTAACCCCAATCAATTAT
CAGAGCTTCAAGCCACCTCATAGAGTCGCGATGTGTCGAATCTCACCTAGTAGAGTACTCTGCCAGGTTGAGATG
AGTCATGCCATCACAGACGGTGCATCAACATCTATTTTGGCCAATGATCTTCTCCAGGCATACAACGGCAACATG
ATGCCAATAAATCTCATGGACACAGCATGTGAGTTTGCTCGGGCCCAACTCACTTCCTCTTTTGGGGAAAAACTA
TCATACTGGAAGAAAAAGCTTTCGGGAATGGATCCCTGCCACTTCCCCAAAATTTCGGGTGCTTCAACACAAGGC
ACCGGTACATCCGTCTGCAAAATTCGTGGCTCTCTGTTTAGCAAAATCCAGGATTACTGCAATTCAGTAGAAGTC
ACGACGGCCAGTTTATTTCAGACCATATGGGCACTTACTCTGGCCGCCTATACCGGCAACGACTCGACATGCTTT
GGGTATCTAGCATCTGGCCGCGACTTGCCTATTGCTGGCATCGATAAATCTATCGGTGCATTCACAAACATGTTG
ACTGTTCATGATCAAGTTATGCAAGATCTGGAGCACCAGCACTGCTCGCTAGCAAGCATCCAGCATGAACTAGGC
ATAAATTCCGATAACCCTCTTTTCAACTCCATCCTATCATATCAGAAGCAGGACGATGAGCCGGCAGGAGACGAG
GGTTTGGTCATCAAGGCCTTGGACGGACAGGATCCCACAGAGTACGACATTGTGTTGAATATTGGGCACGCTACC
GACCACATCGAAATTGTTTTTGACTATAAACACGCCTGTCTTTCAAGCATCCAGGCAGAGAGCGTACTTTCACTC
ATGCAATCTACAGCTGCCGCTCTAGTTCAGCATGCTTCGGGAGATCATCAGACTTTAAGAAGCGTCAACATGGCC
AGCACTGAAGATATATCTGACATATGGGAATGGAACTCAAACGTGCCAGTCACTGTCGACGATTGTGTGCATCAT
ATCATTACGCGAACTTGTCATGAACGCCCCCAAGCTCCGGCAATCTGTGCATGGGATGGCGATTGGACCTATGCA
GAAGTCAACAAGCTGTCAGATAAACTTGCCCACCTTCTAGTCTCCTATGGTGTTGGCCCTGAAGTGGTTGTCCCG
CTTTGCTTTGAAAAGTCAAAGTGGACACCCATAGCAATGATGGCTGTCATGAAGGCAGGAGGCGCATCTGTTGCC
ATGGACTCAACCCAACCAGAGGAACGCCTACGAGCAATCGTAAATCAAGTGAAGTCACCTATTATCTTGTCATCA
TTTGCCAACGAACAGCTTGCAAGCCGACTAATCAGCGAGCTTCCCAGCCCCATCAAAGTCCTCACAATAAGCGAC
AAAGAATTGGAAAATTTGAATGTTCCGAGTGGAAGCCAACTTCCTCATGTCAACCCCAGTGATACGCTCTATGTG
GTATTCACATCCGGTAGTACAGGGGTGCCAAAGGGAGTGGCAGTTACTCACTCCAACATTGCCAGTGCGATCAAA
CACCAGCGACACTCGCTTGGATTCACCTCTGAATCTAGGGTATTCGACTTTTCTTCCTATATGTTTGATGTTGTC
TGGTGCAACTTACTACAGGGTCTTTCTGCTGGAAGCTGCGTTTGCATCCCGAGCGACAATGAAAGAAAGACTGAC
TTTATGGCCGCTATTGTTAGGATGAGGGCAAACCTTGTCATATTGACACCTTCTGCTATCCGCGGCCTGAAGCTT
GACGCTCTGAACAGCCTATGCAACGTCCACTTCATCGGCGAACCTTTACATGTTGACACTTTTAGATCAGTTGAC
GAAAGTGTCACGATATCCAACCTATATGGCCCCACTGAATGTACAACATTCAGCACAATACAAACCATCTGCGGC
AGACAGGATCAGTCAATCACAATTGGCAAGGGAGCGGGTCTGAATACCTGGGTCTCGGACATAGCCACTGGTACG
GCTCTTGTACCAATTGGCAGTGCGGGAGAGCTTCTACTTGAAGGCCCATTAGTCGCCGCCGGCTACCGGGGTGAT
GCTGTCAAAACGGCTGCCGCATTCGTATATGACCCGCCATTTCTTCTGCGTGGATCGGTGGGCCACCCTGGCAGA
CGTGGCCGCCTATACAAAACCGGAGATATTGTTCGGTATAACTCCAACGGTACTTTGACTTTCCTTGGCCGAAAG
GATTCGCAAGTCAAGATCAACGGACAGCGAGTTGAATTCGGTGATATTGAGTCTCACATAAACGGGGCGCTGCTA
CCGGACTTCAGTGAAGGTCAAGCTTTAGTCGAGTTTGTAACACCGCAAGGAAGCTCACGTCCAATGCTTGTAGCT
TTTGTTTACTTCGGACCTAGTGTCACTGAGGGCATGGATGAGGCCGATCTGCTAAGCCTAGCCAAGCGCACAGCC
ATATCGCTGGATGAGAGTCTTGCTGCTCGAATCCCTGCATTCATGATACCATCCGCTTATATTCCATTGCAGAAA
ATTCCTGTCACAGCGACAGGCAAGACAGACCGCCGTCGTTTACGCGAGATGGCCAAAGATGTTACCTGGGACCAG
CTCATTTCAGCTGACTCCCACGGTCCTGATCGTTGTCAACCTGGCACAGAGATGGAGATACAGCTGCAGATCCTA
TGGGGGACTGTGCTAGGAGTTGAAAGTAGTTTGATCGGTGCACACGACAACTTCATGCGCGTCGGTGGTGATTCC
GTGGGCGCAATACGCTTAGCGAGTTCTGCCCGGGAACTTGGTTTCACGCTAAACGTGGCTGATATTCTCAAGAAC
CCGAAACTAAGTGATATGGCAAAACTTATGATACGAACAGAGCCGTCGCAGGATATTTCAATCAAGGAATTCTCT
CTCCTCAAACCTGGCTCTGATGTCGACTGGGCTGTTGCAGAAACATCCGCTTTATGTGGTGTGGACGGTAACCAA
GTCGAAGACTTGTATCCTTGCACACCCCTGCAAGAGGGCTTGCTGGCGCTGACAACAAAGCGCCCCGGCGACTAC
ATCATCCGGTGCATTTTGGAACTGAAGAGATCAACAGACGTCAAAAAGTTCTGCGCCGCTTGGGAGGCGGTGTTG
GAGAGCACCCCAATACTACGAACTCGGATCGTAGACATCGCAGAACAAGGTTTGATGCAAGCTGTCATCAAACAA
CCAGCACAGTGGACATCGGCAGAAACCTCCAGTTTGGTAGACTTCGTGGCTGCTGATAATGAGAAGACAACTGGT
CTGGGTATGCCCTTGGTGCGATTCGGACTAGTGCAAGAGACGAACAAACACTTTTTTGTTTTGACTCTGCATCAT
GCAGTATATGATGGCTGGGCGCTGAATCTGGTCTTCGAAAAGCTCGAAAATTTTTATGCTGGGTCTTCCAGGCAT
GAAAGCCCGGATTTCAGACACTTCGTCAAGCACATTTCAAGTCTCGACAACGACGCGGCTGCCAAGTTTTGGAAA
GACCAACTCCAAGGCTCAGAGGCACCCACTTTCCCCTCCTTACCAACTGCCACGTTCGTGCCCAAGTCTGAAAAG
ACCATTTTGCACACAGTTGAAGAGTTGCAGTGGCCCAAGACGAATGTCACTGCTTTTACGTTGGTGCGTGCGGCA
CTGTCACTTTTAACGGCGGCCTACACCAATTCAGAAGACGTTTGCTTTGGCGTGACTTCCAACGGTCGGCAGGTT
GGGCTCCCTGGAGTAGAAAGAATGATAGGTCCGACTATTGCGACAGTGCCAGTTCGTGTTCGCATTGACCGCGAG
CAGCGTCTCCAAGCCTTCCTCACACAGATGCAGCATCAGTCCATTGACATGATAGCGTTTGAACAATTTGGTCTG
CAGCAAATACGGAAGTCAAGTCCTGACGCCGAACGGGCCTGTAACTTCCAGTCACTTCTCATTGTCCAGCCGGCA
GAAGAGACAGCCCAGTGGCAGAGCGATATAATTGCCCGTGATATCGGAGAAGGAGCTGATGATCCTATGGGCATT
CAAGAAATTGGAACATATGCCCTTACTCTCGAATGCCATCTCGGACCCGACAGTTTGCTCATAAAGGCCAACTTT
GATTCCAATGTAATCGATGAACTACAGGTCAAGCGATTTACAAAGCAGTTTGAGCACGTGCTACGTCAAATATGC
TGCTCTGGTAGTGGCCTTGTCGTTTCTGATATTGATACCACCAGCAGACAAGACATGGAAGATATTTGGAAGTGG
AATGCCGTAGTCCCCCAGTCAGTCAACACGCCTGTTCATGAGCTCATCTCCTCTGTGGCACGCAGACTGCCGCAT
GTCCAAGCTGTATGCGCATGGGACGGCAACTGGACTTACCGTCAACTGGATGACCTGTCAAATTATGTTGCGCAC
CACCTCGTCGGCCTTGGTGTTGGCTCTCAGGACATCGTACCGCTGTTGTTCGAGAAGTCCAAGTGGATGCCGATC
GCGATGCTTGGTGTCATGAAAGCAGGGGCTGCATCGGTGGCTGTCGATACCAGTCAGCCCAAAGACCGACTTCGC
ATGATTATCGACCAGGCAAATCCCACGGTCGCGCTAAGCTCAGCTGATAAGTTGCCTCTTGTCCGGAGTCTGACA
AAGGCGCAAAGCTTCGTTGTCAATGGCCAAGCTATTGACTGCTTATTAAAACCTAGCCTTAATGCTACACTTCCA
GTTGTCGATCCGTCCAGCAGACTGTATTTGGTCTTCACCTCTGGTAGTACGGGTGTCCCGAAGGGTGTTATAATT
CGACATTGCAATTTTGCCAGTGCAATTAAACACCAGAAAGAAGTTCAAGGCATCCTTCCAACCTCGCGTGTCTAT
GACTTTGCTTCATATGCATTTGACGTCGCATGGGCCAATGCGCTACTGACCTTTGAGAGCGGCGCTTGTCTCTGT
ATCCCATCCGATGCTGAGAGAAAGAATGATCTAAACGGTTCGATTGCGCGACTGAAGCCAACTCACGCTGATCTT
ACGCCTTCGGCAGCACTAGTCCTGTCCAAAGAGTCACTTCAGCAGCTTGATACCCTCACTTTAGGTGGCGAACGT
CTCCTAGCGGAGTACGCAACAAAGTGGTCCCAGTTTGTGACAGTTAAAAACTCATACGGACCAAGCGAGTGCACT
CCAACTGCCACATTTACCGAGGCAATTGGGCGTGGATACGATCTTGGTGCTAGCATTGGTAAGCCTGCTGGTCTC
AACACTTGGGTGGTTGATCCTGTGACGGGGCAGTCGCTCGTTCCCATTGGAGGCGTCGGCGAGCTGTTCTTGGAG
GGGCCGCTTGTCGGTGCTGGCTATCTTAATGATGCAGAGAAAACGAATGCTGCTTTTATCCATGATCCACCATTT
TTGCTCCGCGGCAACGTTGTCGCGCAACCTGGACGACGCGGCACGCTGTACAAGACGGGTGACATTGTGCGATAC
AACTCAGATGGCAGTCTCACTTTTGTTTGTCGGAAAGATACACAAGTCAAGATCAATGGCCAGAGAGTAGAGCTT
GCTGAGATTGAGAGTCATATAGCTCTATACACAGCGACCCGACAAGTGGCGACCCTATTGCCTAGCACTGGCCTC
TGTGCAAACAAGCTGGTAGCTATGATCAGCCTCACAGATGTGAACTATGATGTTAGCGAGGACCTCGCCGAAAAC
AAGATTGAGCTGGCATCTTCGGAACATGACCAACTCATCAATGAGCACATCGAGGCCCTTCAATCGTTATTGCGC
GAGTCTTTGCCGCAGTACATGATTCCATCTCTGTGGGTGGTCTTGTACAACCTCCCTATGACAGCATCGGGAAAG
CAAGACAATAAGGCACTCAAATCCTGGCTGGAAAATATGGATGAAACGCTCTTTTCTAAAATCAACAATGCGAAC
GGTAGCGACATTATCCGAAAACCAGACACAGAAGACGAAAGAGCTCTCATCCAGAAATGCAGTATCGTCCTTAAT
ATGCCCGTCGACAAGATCAATCTCGACAAATCTTTTATTGCGAATGGTGGAGATTCCATTTCCGCCATGAGGCTT
GCATCCCACTACAGAACTGCGGGAATTTCCATCTCAGTCTCAACACTCCTTCAAAGTAAAACCCTCGCGGATTTC
GCAGCATTTTCGGGCGCAACAGCCATTACCGGAGTCAGTCAGGAAGAGCATACTGACGTTCCTTTCGAACTATCA
CCCATCCAGCAGTGGTTCTTTGACCAATCGCCATTTATGAGCCAGCAGAAGCATGACAGATTCTACAACCAAGGA
TTCTATGTGAGACTCAGGCGCACAGTGGGAATCAATGATCTAGAATCAGCCTTTCTTTCTCTGGTCAATCGGCAC
GCGATGTTACGCTCGCGATTCCAGCATCATGGGGGCAAATGGAAGCAAATAATCCCCAGTCACGGCAAACGAGCT
CTTCATTTGAACGTATCGCAGCACCTGTCCATGAGCGAGATTGCATTGTTAGCTCAAGAGCGGCACCGACAGATT
GACATAGAGCAAGGTCCTGTCTTCTCGGTTGATATTTGCTTACTAGGCCAGCAGCAGCATCTGGTCATGATAGCC
CATCATTTGGTTACCGATTTGGTCTCCTGGCGGATTATCTTAGATGATCTGGAGACTATTCTCAACGGCCATTCC
CTAACGGCCGCTCTATCCTTCCAAGTGTGGAGCAGGCTGCAAGCTGAGCGGGCTGTATCTTCCACTTTGAAGCCT
CACAACTTGCTGTCGACTGACGGCGTCCATAACAATCTCAAGTTTTGGAAGTATACGCACGACACGCCCAACTGC
TTGGCAGACCACAGGCTCCGATCGGTCACCATTGATCGAGAAACTACGGCTGTACTACTGGGCGAGGCAAACAAA
GCCATGAATACAGAGCCAGTAGAGATCCTTTTATCAGCTGTTTGGGATGCATTCTTTCGGACGTTTTCCCAGCGC
AACAGCCTGACCATATTCAACGAAGGTCATGGTCGCGAAGCTTGGTCCGATGAAATTGACTTGTCGAGCACTGTT
GGATGGTTTACCACCCTCAGTCCCATCAACATCTATAGAAATAATGCCACCAGCGAGACCGACATGGTGCGGCTC
GTCAAGGATGCCCGCCGCAGCCTTCCCGCGAACGGCTGGTCTTACTTTACCTCCCGATATCTGAACCCCGACGGG
CAAAGAGCTTTTGAAAGCCATAACACAGTGTCTGAAGTTGTTTTCAATTATCATGGCCAATTCCAACAACTAGAA
AGTCATCAAGCCCTTTTTGAAGACATTGATCTTGTCGGTGTACGTGAGCAAGGTCGCTCAATATCTGCAGGGTCT
TTGTTTAACATCGAGGTTGCCATTGAAGCAATGCAAGCGCACTTTGAATTCTCCGTTAATCAAAATATCGCTCAT
CAGAGCTTGATTAACCAGTGGATTGACCAGATTCAACCCTCTTTGGAAAGGATTTGCCTCGTCCTTCTCGAGGCC
AACCCAACGCATACGCTGTGTGACTTCAAGTTCATCAGTCTCGACTACCAGCGCCTTGACGATCTTACCAGTCGG
CTACTTCCGGAGATCGAGTCAATCAACCAATCAACTGTTGAGGAGATTTTCTCGTGCTCTCCGATTGTCGATGGA
ATGCTCCTCAGTCAGATAAAGCAGCCCGAATCATACAAGACACTTCAGCGATACGAGGTGTTGTCATCTCATGAC
CATCCTATCTGTCTCGACACCCTCAAAATTGCTTGGCAAAAGGTGATTTCTCGCCAGCCTGCCCTGAGGACAGTT
TTCATCGCTGGCCTTGACGGATCTACCGCCTTTTACCAGGCCCTTCTCAAAGAGTGCTCCGGGGATGTTATCGTT
GTTGAGGCTAAAACTGAAGAGGAAGCCCTGAAAGCCTTTTCCTCGCTTCCGAAAGTCGATTACCAACAGGCCAAA
CCTCCTCATCGCCTCACTCTTTGTCAAACGCCGGATGACAAAGTCTTTTGTCAGATTGAAATGAGCCATACTATT
ACTGATGGTGCCTCTTCCAACATTTTGATTAAGGATCTGATTGACGCTTATGGTGATAGGCTGTCGTCAACAGAC
CTTGACAAAACAACACGCGAATTTGCTAGCCACTTGCTGGCTAAGCCACAGTCCCAAAAGATTTCGTATTGGAAC
ACAAAACTCAAGGGCCTTGAACCTTGCCGCTTTCCATCCCTATCGAGCATGTCTCGGGAGAAGCACGAGTGTAGC
TCGGAGATTGGAGTTTTTGTCGAAGACAAGATGTTTGCGCAGATTCAAGACTTCTGTAGCATAAACCAGGTCACG
CCAGCAAGTCTCCTCAAAAGCGCCTGGGCTTTGACACTCTCGACCTACGTACAAAATCAATCTGTCTGCTTTGGC
TATCTGGCATCTGGTCGAGACCTCCCAATCGCCGGGATGGACGAATCTGTCGGCGCTTACACTAATATCATGGTC
TGCCGTGCCGATTTGGATGGGCAACAGCCTGGTGTGGCACTCGTGCGACAACTTCAGGATCAATTAATGCAGGAC
TTGAGCTTCCAACATATATCGCTTGCTAGCATTCAACATGAGCTTGGACTGGCGTCCGATCAGCAGCTTTTCAAC
TCTATTGTCTCTTTTCAGAGGTCAGGAGACGATAATGAACAATCAGCAGAGGAGGGTAAACTTCGATTCAAGAAT
ATTGATGGTTTGGACCCAACAGAATACGACATCGTATTGGGTATCAACCAAGGAACCAGGTCCATCGAAATTGAC
CTTGAATTCTCACACAGCTGTCTCACTAGTAATCAGGCAAAACGCATTCTCGAGCATCTGGAGTCAAACATTGCC
GCTATTCTTCACAATGAGCCACCTGCTCTGATCAGCCCCCAAGATGAGCAAGATATTTGGAGCTGGAACTCCACT
GTTCCTGACATGGTCAACATCTGCGTTCACGATCTGATCTCCAAGATAGTATTCCGCCAGCCTGATGCACCAGCT
GTTTGCTCATGGGACGGCGATTTCACCTATGCGGAGCTGGATAATTTTGCAACACGCCTTGCCAATAGTCTCAGC
AAGATGGGCATCGGAAGAGGCAGCATCGTCCCGCTATGTTTTGAAAAATCAAAATGGACACCAGTTGCCATGCTA
GCAGTTATGAAAACAGGTGCAGCCTCTGTTACGATGGATACTAGCCAGCCTGAAGAACGGCTCCAGTCTATTGTT
GCACAGGTGGATGCTAAACTTGTGATCTCTTCGACATTGAAGGTTGAGCTAGCAGCCAGGCTCACAACGGCTCCC
GTCTTGGCTATAGACAAAGCCAGCATGAAGGCGATGGCTGATGATACGCCGCTGGCTGCAGTCGATCCCGCAAAC
AGTATTTACATTGTCTTCACATCAGGGAGCACTGGCACGCCAAAAGGTGTCATCATCACTCATACTAACTACAGC
AGCGCCATCAAGCATCAGCAGAGTGAACACGGCTTCAAGCCATCCTCTAGGGTCTTTGACTTTGCCTCTTATGCG
TTCGATGTCAGCTGGTCCAATTTCTTGCACACCTTGACCATTGGGGCCTGCTTATGCATACCTTCTGATGATGAT
CGTAAAAATGACCCGGCGGGCGCAATTGACCGCTTACGGTGTACACACGTTGATATGACCCCCTCGGCCGCAAGC
GTCTTACCTGCCAGTACGTTGGCTAAATTGGATACCATTGTTCTGGGAGGCGAGAAGCTGTCGCTTGAATATGCC
CAACGCTGGTCCGCCCTGACAAGCGTGCGTAATCCGTACGGGCCTTCTGAATGCACACCGACGTCGACAATTACG
GAGATCAATTCTGCGGAAATAAGCAAGGGCAAAGTGAGCATCGGCAAAGGAGTGGGACTCAATACTTGGATTGTT
GATCCTGCCACTGCACAACATTTAATGCCGATTGGCATCCCTGGGGAGTTATTACTCGAAGGTCCGCTTGTTGGT
GCTGGCTATCTTGGAGACCCTGTCAAAACCGCTTCAGCATTTATTGAAGACCCAGAATTCCTAGTCAAAGGCGCT
GGTCCAGGAATTCCAGGCCGCCGTGGTCGTCTGTACAGGACGGGCGATCTAGTCACCTATAATACCGATGGTAGC
TTGTCATTTGTGGGCCGAAGGGACTCTCAAATCAAAATAAACGGGCAACGCGTCGAATTAGGCGACATCGAGTCG
CACGTTTCTGCAAACCTGGTGAGTCATGGCAGTGCTCAGGTTGCGGTCGAGGTTGTGTCACCCCAAGCTAGCTCC
AACAACATACTTGTCGCCTTCGTGAGCTTTGACGACCTGAATTATATCAACCTGAATGATGAAAAGCTTCTTGCC
CGCACGAAAGCGGCGACCGAGGGAATTAGGGAGAAACTCGCGACACAAATCCCATCTTATATGATTCCTTCGGTC
TACATCCCTGTTACTGTTTTTCCGACAACAGCTACTGGGAAGACTGATCGGCGCCGATTACGTGAAATGGCCTCA
AGCCTCACCCTGGAGCAGCTTACCTCAATCAACCAAGCTCAACAGCAATATCAACCCCCCACTACTCCTTTGGAA
GTGGCACTTCGGGAGCTCTGGATCTCAGTTCTCAAATTAGGATCGCGAAAGATTAGCACTACAAACAACTTCTTC
GAACTTGGTGGAGATTCCATCGGTGCTATGAGGCTGGTAGGCGCGGCCCGTGACCACGGACTATCGCTTTCCGTT
GTAGATATTTTCAAGCATCCTAAGTTCAGCGAAATGGCTGCTTTGCTCCGTTCTGTGGATAAGCCGCAGTCGGAA
GAGCCACGGGTATTTCAACCCACTTCGCTTCTGTCCAAAGATCACAACAAAGACCAGATACTCTCTCGACTCTCT
GACTTTGGTATTGACTGGGAAAATGTTGAAGACATCCTCCCTGTCACAGATCATCAAGCTCGTTCCATCGCGATG
ACTCACTCTGCGTCCCGCGACTTGCTACTCTATCACACTTTAGATAGCAAGGGCGTGCCAAATATGCGCAAGATG
CGAGCAGTGTGCAATGAGCTCGTCAATAGATATGATCTCTTGCGAACCCTTTTCATCGCACATAAAGACAGCTTC
TTGCAGGTCGTGCTGAAGGCCTTTCCTGTGGATATAACCGTCTTGAGAATCGAGAATGCCAGCCTAGAAGAATGC
ACAGAAGAGCTACGATTACGCGACAGGGACGATGAGCTCCGTTATGGCTCGCTCCTAACAAAGATTGCTATTTTG
CATCAAATTCGCGACAACGAATACCGTCTTGTGGTCCGCATTTCCCATGCTCAACATGACGGAATGAGCTTGATG
AAAATGTGGAACGCATTTGAAGAAATGTACGGTGACGGGAGTGACGACTCATTCCACATTCCTTCGGACACTAGC
TTCCAAGAAAAGTCCAAGGCTAGTTTCTCCAACTACATGCATGCCGTGGCTGGTACAAACCGGGAGCAAGCTAAG
TCTCACTGGCGCAGACTCCTCAAGGGCTCCAGTATGACGAACCTCAAGCCCCATGCTTCATATGCCCTGACCTTT
GGCGAAGGACCATGTGTCGCCAGACATGTTCCTAAGAGCATTGCTCAAGGTACTGGATTTACATTTCCTACTGTA
CTGAAGGCTGCTTGGGCGTACGTTCTGGCAAAACACCTTGCCAAAGACGACGTGGTTTTCTGTAACCTCACTCAC
GGTCGGGGCTTGCCCGGGACACAAGATGTCTTTGGAGACTGCGTGAACATCATTCCTACTCGAGTATCCTTTACC
GACGGATGGACTGTTCGCGACCTTCTCAGTGCATTGAACACGCAACAGATTGCGAGCATGGAGCATGAGAATATA
GGCACACGCGAAATTGTCCGTGACTGTACTACATGGCCGAAGTGGACATATGCAGGATCCATCGTTTATCACCAT
GACTTTGACGATGGAGAACATATTGCTCATAACCGCAGTATGCACGTTGAGCAGGAGCTAGATCTGTCTCACGGC
AAAGTGGACATGACCGACGTTCATATCACTTCTAAGCCTGATAACAACATGTTCCGAATTGAGCTGGACTTCGCA
CATGGCGTAATATCTGAGCGTGACGCTGAACTGCTGGCTGCGAAACTGACGGAATCTATCATCGTTTTCTGCAAT
GTCATGGACCAGCCTTTGTTATCTCCCGACCAGATCAGATATCTGCGGACAACCACATTGCTGCCCTCAGAGGAG
CCTCTCAGTGCAACCCCAACAAATGAACAGTTAATGGTTGCTAGCATTAGCCCGACTGAAATGCAATGGGCGCTT
GAGAGTGCGTGGAGGGACACTTTCAATTGCCGCCTTAGTCCTGAGGTGAAAGCGGGCAAGACAATTTTTGATCTT
GGTGGTGACTTGGTAAGCGCTAGTCTGATATCAGCTCACATGGAGAGGCAAGGATATGTTCTTAGTGTTGAGGAT
GTCTTGGGGAATCCGACTTGGTTCTTGCAACTGACGCTGCTGACGAAGCGCTCCCTTCGGGATGTTGATGTCTGA
Gene >Ani_SJS100_1|g9357.t1
ATGCGATCTCCCAATGATCTTACAACATCAGCAACCATGGAAGATATTCATCAAATATGGTCTTGGAACGCTAAC
GTGCCTGAGGCGGGTGAGACATGCGTTCACACCCTCATCACCGACAAAGCTCTCCAGCAGCCAGATGCACTTGCC
GTCGACGCTTGGGACGGGAGGTGGACGTATGGTGAGCTTGAGAATACTTCTACCAAACTGGCATTGCGTTTGCTT
GACTCTGGAGTTGGCCCTGGAACCAATGTTGTCATATGTTTTGAAAAGTCGAAGTATACGCCTCTGGCTATGCTG
GCCGTCATGAAGGCGGGTGGAGCCTCCATTGCACTCGATACAAGCCAGCCACAGACTCGATTACAGTCTATCATC
AACCAGGTCGACCCTGTAGTGATACTATGCTCCGCGTCCAAGAGCCAGTTGGCCAAGTCAATTATCGCCGAGTCT
GCAGTAGCATTGACAATTGATGAAAATTCTCTATCCGAAATGCATTTCGAGGCGGACTCAGTCGCCCGTCTCCCT
GACGTCAGTCTGGACAACAATCTCTACGTGGTCTTTACCTCCGGAAGTACAGGAACTCCCAAGGGAGTCGTCGTC
ACACATCTCAATTATTCTACTGCCATTCTCCACCAACAAGAAGCGCATGGATTCAAGTCCACTTCAAGAGTGTAT
GACTTTGCTTCGTATGCTTTTGATGTGAGTTGGTCAAATCTCATCCACACCCTCACCATCGGCGCCTGCCTGTGT
ATTCCATCAGAGCAGGACCGTAAGGACAATCTCATCGAGTCCATACGCTCACTGTGTGCTACACATATCGATGTG
ACCCCGTCTGTTGCTCGCCTTCTCCCTGATACCTTGCTCTGCAAGATTGAAACACTTGTTTTAGGTGGCGAAAAG
CTGTCTGCAGAGCTTGCCAGACATTTATCATCGCTAGTAACATTGAAAAATCCGTATGGACCGAGTGAATGTACG
CCTACATCAACTATCGCTACAATTCGACCGGATGATGATGATTCAAAAATTAGCAGCATTGGCCGAGGCTTGGGT
GTCAACACCTGGGTTGTAGACAGTGAGAATGAAGGAATTTTGGTGCCTATTGGACAGGTTGGAGAGCTATTACTT
GAAGGGCATCTGCTTGGCAATGGCTACTTGAACGACCAGACGAAGACCACTGCAGCCTTTGTCAACGATCCGCTT
TTTCTGCTCAATGGCGGCGATGGACCTGGGCAGCCTGGGAGGCACGGGCGTCTCTACAAGACCGGCGACCTGGTC
CGTTACGAGAAAGACGGTAGCTTGACATTTATTGGCCGTAAGGACACGCAAGTCAAGATTAACGGCCAACGAGTT
GAGCTGGGTGATATTGAGCATCATATTAACCGCCACATCCCACATGGTACCGTGTCTGTGCGACAAATTGCAGCA
GAAATTATTTCACCAAAGAGGGGTTCCAATGCTGTCCTGGCAGCATTCCTCGAGGTCGACCTTGGTGTAGAGGAT
ACGGGAATAGCGGAACAGTTGTTTTCAAAAACAGAGAAGATGATGTCTAACTTGAGAAGCAATCTTGCTCGAGAT
GTCCCTTCATATATGGTTCCTGCTGTATTCATTCCGTTGAGGAACTTCCCATTGTCTCCGACAGGCAAGACAGAC
CGACGCCAACTGCGGGCCATTGGTGAATCAATGGACTTGACTGTCTTGGCAGGCTTTGGCGCAGCACCTAATGAG
GCTCGGATCCCTCTCACTCTGCGAGAGAAACAGTTGAGAAGACTCTGGGGCTCTATCCTCAGGATTGACGAAAAC
CTTATTGCTCTCGACGATAACTTTTTGCAAAGAGCCAGCAACCCAAATGCAGCCTTGAAACTCGTCACTGCAGCT
CGAAGAGAAGGCTTCTCCCTGAGCGTGGCCAACGTGCTGAAGTATCCGCGACTTCAGGACATGGCACATGTGGTT
GAAACAGTGGAGCAAGAGCAGGCACCTGAAATTATGCCATTTGAGCTTCTGAGCAATGATATTAATCTTGATCTA
GCCCTCAGAGAGGCTGCAGCATCGTGCAACGTACAAGGGAATCAAATTCAAGACATTTATCCCTGCACACCGCTA
CAGGAAGGCATGATGTCCCTATCCGCAAAACGCGAGGGTGATTACATTATGCAGTATACGCTGGGGCTACACCAT
CGATGCGACATAGAGCGCCTAGGTAAAGCCTGGGCAACAGTAGTTGCTACGACGCCCATTTTGAGAACACGAATT
GTCGACATCACTAGCCAGGGGTTGGTACAGGCTGTTCTAAACGAGCAGTGGTCAAGTTCGTCGATCCAAAGGAGG
ACTTTGAGCCAGGCGAGAGACCACAAGCATCAATTCGGGCTAGGCATGCCACTAGGCAGATTTGAAATTGTCACC
GGCGACTCGTCTGATTCTAAGCACTACTTCGTCTGGACACTGCACCATGCCCTGTATGACGGGTGGTCACTTCAG
CTTTTACTCGAAAAGCTCGAGAACGAGTACGCCGGAAAGGCAGACGCGCAGTCAAACTCACCCGATTTTAAACGT
TTTATCAGGTATATTTCAACGAGGGATGGCGAGAAGACTCATTCATTCTGGACCGAACAGTTCCAAGACGTCGAA
GCCCAGATCTTTCCGAGTTTGCCATCTGTCGACTACCAGCCTAGATCGGACAAACTGTACACTCATTCTTTGGAA
GGAATACAATGGCCGAAAAATGGAATCACCCCATCGACGACAATCCGTGCGGCTTACTCTATCTTGATAGCCAGT
CTGACCAACAGCCCAGATGTTGTCTTCGGCAACATAACGACGGGCAGACAAGCCGCCGTGGATGAGGTTGAAGAC
CTTATTGCACCAACTATAGCCACTGTACCTGTGCGCGTTTCGATCGACAGCAAAGACGAGTTGGGACAGTTCTTA
CAGCGAATTCAATCTCAGGCCGCAGATATGATTGAGTTTGAGCAGACTGGGCTGCATCAGATTCGACATATCAAT
GCAGACGCGGAGCGAGCATGCCAGTTTCAGACACTGCTTGTTGTTCAGCCCGCGGAGGGCTCGGCCACAGCACCG
AGCAACATTTTTACCAACATTGCCGACGACATAAGGAAAGGAGATGGAAACAGCGCCGCAGAGCTGGGGACTTAC
GCCTTGACTATGGAGTGTCTGCTCAGGAAAGATGGCCTTGACCTCCATATGAACTATTGTTCCGCAGTCATATCG
GAGCATCAAGTGCGCCGTTTGTCACAGCAGTTTGAGCATGTCCTTGGTCAAATATGTCATCTGACGATGATAATT
CACAGACAGAAAACAACACTTGAATCGCTGCGGCAGCCAACAACGGAAACTGAGCGGCAGATGCAGCGAATCTGG
GCACAGGTACTCAACCTTAATCAAGCATCAATTGGGCTAGATTACAGCTTTTTCCAACTCGGCGGCGACTCTATT
GCTGCCATGGAAGTTGTGACAGAAGCTCGTAAGCTTGGCTTGAAACTGGCTGTGTCAGACATATTCCATCGCCCG
AAATTGCAAGACGTTGCAAAGAAGGCTTGTGACAGTGGCCTGCAGGTTTATGGAGAAGACCAGCTCATGAACGAC
TCGGAAGTCCAAGTTAATGGAGGCACCGAGCACACTAAGCTACCCGATGATGACAAGGCAGTCGCTGGCCATGAA
ACGCAGCAAGTCATGGTATGGGAGGGAATGTTCGATAAGGAGGTCTATGGAACTATTGATAATGTCCAATTGGAG
AAGATTGGGCGCGACTTCATCGGATGGACGTCCATGTACAATGGCAACCAAATGGACAATGTCGAATTGAACGAG
TGGCTAGACGATACTATTGCCACAATACGCAGCAGCGGATCGACAGCCAACATACTCGAGCTGGGGTCCGGCAGT
GGAATGATCTTGTTCAATCTTGTCAACGGCCTGCACAGTTATGTTGGACTTGACCCGTCAGAAAAGGCCGTGGAC
TTCGTTTGTTCCACAGTTAAATCCATTCCCCAGTTGGCCGACCGTGTCTATAATATAAAGGGAACAGCAGACAAC
ATCAACAGTCTAGGCGTACCCATCTTTGCTAACATGGTCATCGTGAACTCTGTCGTCCAGTACTTTCCCAGTCAA
GACTATCTGCTCAAAGTAATTGAGGACCTAGTTCAGCTGGAAACAGTCCGCACGATCTTTTTCGGCGACATTCGC
TCCTACGCGCTGTTTCGAGAGTTCCAAGTTACCAGGGCGCTGCATATTGCAGGAGATACTGCAACCGAGGACGAG
ATCCGACAGATGATGGCCAACATGGAGCAAGTCGAGCTGGAGTTGCTGGTAGATCCCGCTTTTTTCACATCCTTA
GTCGACCGGTTCCCTGGACTCGTCGAACATGTGGAGATTCTTCCAAAAAGATTGAAGTCGACGAATGAGCTGAGT
GCCTATCGATACGCTGCCGTCGTGCATCTCAAAGACTCAAACCAACTGGCTCAGCCATTACAACTCCACGATATC
CAGAAAGAGAGCTGGATTAACTATTCCGGGCGTCAACTCAATCGTCAGTCGCTGTTACAACTTGTACAGGATTCT
TTCTTACGAGACCCGTCCCCCTCATCAGTTGTGGCTGTATGCAATATACCTTATAGCATGACAGTCTACGAGAGG
CACGTGATTGAATGGCTTGATAGTGGCCTCACTGCCGGTCCCGATGCCGAGGACTGGCTCTCTTCTATCCGCCAA
ACATCACAAGAATGCTCGTCACTCTCGGCTCTCGATCTGCAACAAATAGCTCACCAGACAGGATGGCAAGTGGAG
ATCAGCTGGAGTCGGCAATTTTCTCAGCGCGGTGGCTTGGATGCCATATTCCACCGACACCATTCACGAGGAGAC
CGAACCAGCAGGGCTTTGTTCAACTTCCCCACAGATCATCAAGGACGGCCATCTCAATCGTTGAGCAATTGGCCT
TTGCAGCGCAAGCAACAGGGAGAAGAAAAGCAAATAACTTTGGGAGATGTTTCCACCGTCTGCAAAGAGGACTTG
CATGACATCTGGACTTGGAATGAAGTTGTTCCAGACGCCCTCGAGGCCTGTGTCCACGATCTCATCTCGGACACA
GTAAGAGCTCAGCCTCAATCCCCTGCTATTTGTGCTTGGGATGGTGAGTGGAGTTACATCGAGCTTGATGATTTG
TCTAGCCGTCTTGCACACGCGCTTGCTCCGTTTGGCGTTGCTAACACAGTTGTACCTATATGCTTTGAAAAGTCA
AAATGGACACCAGTGGCAACGCTGGCTGTGATGAAGGCCGGGGCAGCGTCAGTCACCCTCGATGCCTCTCAGCCT
CTGGAAAGATTACGGTCGATTATCTCCCAGACTGACCCTCGGGTGATCTTGTCATCGGCGTCTAAGCAGGGCTTG
GGTGCCCAACTCACTAAAGCTCCAAACCTTGTTGTTGACCAACATTCCATTTCTACTATGCACATCACCGCCGAG
CCTCTTCCCACCGTTGACCCCTCCAGCAAGCTATATATTGTTTTCACATCTGGCACCACGGGTGTTCCTAAGGGC
GTTATTATCACACACTCTAACTTTAGCAGTGCCATCCGACACCAACAAAAAGCTCATGGTTTCAAATCGACATCT
CGGATTTATGACTTTGCCTCATACGCGTTTGATGTTAGCTGGTCTAACTTCATACATGCACTTACTATTGGTGCC
TGCTTGTGTATTCCGTCAGATGAGGACCGCCGTGATGACTTGGCCGGGTCGTTGGAGAGGTTCGGCGCTACCCAT
GTTGACATGACGCCTTCCGCAGCAAGCTTGCTCCCAGAGAAGTCATTCAAAAGGCTTGAGACGGTTGTACTCGGA
GGCGAGAAGCTTTCTGTCGAGAGCGCACAGCGCTGGAGCTCACTGGTCAGCCTCAAGAACCCATACGGTCCCAGT
GAATGTACGCCCACGGCTACCATTGCGACGGTAACACCCACCGATGAGTACAAATCCAGTATTGGAAGAGGACTA
GGTCTGAATACATGGATTGTGAATACTGCTACAGACTCTTTAGTTCCAGTCGGCGGAGTCGGAGAGCTCCTGCTC
GAGGGACCTCTCGTTGGCGCAGGGTACCTCGGCGATGACACAAAGACGGCCGCTTCCTTTGTGCAAGACCCTCAG
TTCCTATTGCAAATTTGCCCTCAAGGTCAAGCAAGACATACCAGAATGTATAAGACTGGCGATCTGGTTCATTAC
AACCCGGACGGAAGTCTTAGTTTCATTGGGCGCAAGGACGCTCAGGTCAAGATTCATGGTCAGCGTGTTGAGTTG
ACCGAGATTGAGAGCCACATTCGTCGCATCTCTAAGACTATCCAGGTGGCTGTTTTGTTTACCAAGTCAGGGCTG
TGTGCAAATAGGGTAGTTGCATTTGTCTGCATCCAGGGAACTGGCCAAACTCAGACAGCCGCCGATCAAATTAGA
CTCATCGATCCCAAGTATTCGACCCTTGTTACGGCTTACACCGAGTCCGCAAAGTTTAGTCTCAGCGACACTCTT
CCTGCTTATATGATTCCCTCAATTTGGATTCCACTCCAGCATGTTCCGTTGTCAACGTCCGGAAAGCTCGATTAC
AAAGCTTTGAAATCATGGCTTGATAGCATGGATGCCAAGACGTTTGCCAATATTTTAACTGCGTCTGATGGCGAC
GTGAAGCTTCGCAAGGCTGAGACAGAATTGGAACAGGTCATAGTAGAGGCTTGCGCTACAATTCTCAACATTACA
GCATCGAAGGTGAACCTGGATCGGTCGTTCATTGCGAATGGAGGTGATTCCATATCCGCCATGAGGCTCGTTGCT
CATTGTCGCGCGGACAACGTCGTATTTTCGGTGGCTAAATTGCTAAAGAGCAAAACTTTGGCCGCTTTGGCCTCA
TCTTCAGAAATCAAGTCAGCTTCCAACGTGTTGGGCTTCTATGAGGAGAAAAGTGACTCTTTTGCGTTGTCGCCG
ATCCAACAGTGGTTCTTTGAACAAGGTCTCTACAAGAGATCCAATGACAACTTCGACAATCAAGGATTTTATCTC
AAGGTTAAGCGCCCATTATTGACAAAGGATATTGACTCGGCGATTTCCAAAGTTGTTCAGCATCACTCTATGTTG
AGAGCTCGCTTTCATCGGAACGGCGACGAGTGGACCCAAAAAACGCTTAAGCCTGACACCAATGGTTTATATCAC
TTTGGTGTTCAACACACGTGCCTTCCAGCTGATATAGAGCGACTAGCTCTATCACGCCACCAGATGATCGACATC
GAAAAGGGGCCAGTATTCTCTGCTGACATTTGCCATAATGCGTTTGGAGAACAGTACCTGATCCTGATTGCTCAC
CATCTTGTTGTTGATTTAGTCTCGTGGCGTGTCATCCTGGAGGACATAGAATCTCTACTCGGTGGTAGTAATTTG
CAACCAAGTCTTCCATTTCAAGTCTGGAATGATATGCAAATTGAGCGGGCGAAGGAATCGAGCCTATTTGATCCT
GAAAATGTTCTTTCGACCACTGGAATTAATAACAAACTTGATTTCTGGCAAGCCACAGCAGAAACCAAGAACACC
GTCGAAGATCACCTAAATTTCTGTATCAAGATCGACAGCAGCATTACAGAGCTCATCCTCAAAGACGCAAATTAC
CCGTTCAACACTGAACCTGTGGACCTCCTTCTTGCGGCTGTTTGGCATGCATTCTTCAAGACGTTCCCCCAAAGA
GACGGTCTCACCATTTTTATTGAGGGACATGGTCGCGAGCCGTGGTCCTCAGATATTGATCTTTCCCGCACTGTC
GGCTGGTTTACTACCATCAGCCCCATCCATGTGTCAAAGAGCGACGTACACAAGTCTGTCGCAAGTCTAGTACGC
GTTGTCAAAGATGCGCGGCGGCTCCTGCCTGCAAATGGCTGGGCTTACTTTGCTTCTCGATATCTCAATGAATCA
GGAAAATCAGCGTTCAAATCGCACGACTCTATTATGGAAATAACCTTTAACTATCACGGCCAGTTTCAACAGCTG
GAGAACGAGAAGGGGATGTTTGAAAATATTACACTCAGTGGAGTCTGCGAGCAAGGACCAGCTCTTCCCGCCTCT
TCCTTGATTGCTGTCGAAGTCTCGATAGATCGAGGGCAGGTCACCTTCGACATTTCTGCCAACCGCTACATTAAT
CACCAGGATTGTATTTCAAACTGGATCAAAGCAATTCCACAGTCATTGGAGACCATTTCCAATGAGCTTGTGTCT
ACAGCAATCTCACATCGCACGCTTTGCGACTACGAATTTCTGAGCCTCGGGTATACGGAGCTGGATCGATTACAG
GAAAGTGTCATCCCAGAAATCGAGAAGCTAAATAATTCCACAGTAGAATACATTTACCGCTGTCTTCCCACAGTT
GATGGTATTCTGATCAGCCAGTTCAAAGACCCAGAATCGTATAAAACAGTGCAACATTTCGAGATTACTTCCCAC
AACGACGACCAAATCGACCTAGAGCATCTTTCTCTAGCATGGCAAAAAGTGGTTGCCAATCAACCTGCTCTACGA
ACCGTCTTTATCCCTGGCATGGATAAAGCTGCTGCATTCAATCAAGTTGTGCTGTCTCAGTACCACGCCGAGCTC
ATCATCCTGCGTACTGCCAGCGACGAGTACACCGAAGCCTTAGAGATGTTCAAGAATCTAACCCCAATCAATTAT
CAGAGCTTCAAGCCACCTCATAGAGTCGCGATGTGTCGAATCTCACCTAGTAGAGTACTCTGCCAGGTTGAGATG
AGTCATGCCATCACAGACGGTGCATCAACATCTATTTTGGCCAATGATCTTCTCCAGGCATACAACGGCAACATG
ATGCCAATAAATCTCATGGACACAGCATGTGAGTTTGCTCGGGCCCAACTCACTTCCTCTTTTGGGGAAAAACTA
TCATACTGGAAGAAAAAGCTTTCGGGAATGGATCCCTGCCACTTCCCCAAAATTTCGGGTGCTTCAACACAAGGC
ACCGGTACATCCGTCTGCAAAATTCGTGGCTCTCTGTTTAGCAAAATCCAGGATTACTGCAATTCAGTAGAAGTC
ACGACGGCCAGTTTATTTCAGACCATATGGGCACTTACTCTGGCCGCCTATACCGGCAACGACTCGACATGCTTT
GGGTATCTAGCATCTGGCCGCGACTTGCCTATTGCTGGCATCGATAAATCTATCGGTGCATTCACAAACATGTTG
GTTTGTCGAGTCAATATTAACCGAGAAACTGGAATACTTCAATTTGTTCAGACTGTTCATGATCAAGTTATGCAA
GATCTGGAGCACCAGCACTGCTCGCTAGCAAGCATCCAGCATGAACTAGGCATAAATTCCGATAACCCTCTTTTC
AACTCCATCCTATCATATCAGAAGCAGGACGATGAGCCGGCAGGAGACGAGGGTTTGGTCATCAAGGCCTTGGAC
GGACAGGATCCCACAGAGGTACGTTGTATCGCATGTCAAAGTTCTTTACGGAATCTGACAAATCCTAGTACGACA
TTGTGTTGAATATTGGGCACGCTACCGACCACATCGAAATTGTTTTTGACTATAAACACGCCTGTCTTTCAAGCA
TCCAGGCAGAGAGCGTACTTTCACTCATGCAATCTACAGCTGCCGCTCTAGTTCAGCATGCTTCGGGAGATCATC
AGACTTTAAGAAGCGTCAACATGGCCAGCACTGAAGATATATCTGACATATGGGAATGGAACTCAAACGTGCCAG
TCACTGTCGACGATTGTGTGCATCATATCATTACGCGAACTTGTCATGAACGCCCCCAAGCTCCGGCAATCTGTG
CATGGGATGGCGATTGGACCTATGCAGAAGTCAACAAGCTGTCAGATAAACTTGCCCACCTTCTAGTCTCCTATG
GTGTTGGCCCTGAAGTGGTTGTCCCGCTTTGCTTTGAAAAGTCAAAGTGGACACCCATAGCAATGATGGCTGTCA
TGAAGGCAGGAGGCGCATCTGTTGCCATGGACTCAACCCAACCAGAGGAACGCCTACGAGCAATCGTAAATCAAG
TGAAGTCACCTATTATCTTGTCATCATTTGCCAACGAACAGCTTGCAAGCCGACTAATCAGCGAGCTTCCCAGCC
CCATCAAAGTCCTCACAATAAGCGACAAAGAATTGGAAAATTTGAATGTTCCGAGTGGAAGCCAACTTCCTCATG
TCAACCCCAGTGATACGCTCTATGTGGTATTCACATCCGGTAGTACAGGGGTGCCAAAGGGAGTGGCAGTTACTC
ACTCCAACATTGCCAGTGCGATCAAACACCAGCGACACTCGCTTGGATTCACCTCTGAATCTAGGGTATTCGACT
TTTCTTCCTATATGTTTGATGTTGTCTGGTGCAACTTACTACAGGGTCTTTCTGCTGGAAGCTGCGTTTGCATCC
CGAGCGACAATGAAAGAAAGACTGACTTTATGGCCGCTATTGTTAGGATGAGGGCAAACCTTGTCATATTGACAC
CTTCTGCTATCCGCGGCCTGAAGCTTGACGCTCTGAACAGCCTATGCAACGTCCACTTCATCGGCGAACCTTTAC
ATGTTGACACTTTTAGATCAGTTGACGAAAGTGTCACGATATCCAACCTATATGGCCCCACTGAATGTACAACAT
TCAGCACAATACAAACCATCTGCGGCAGACAGGATCAGTCAATCACAATTGGCAAGGGAGCGGGTCTGAATACCT
GGGTCTCGGACATAGCCACTGGTACGGCTCTTGTACCAATTGGCAGTGCGGGAGAGCTTCTACTTGAAGGCCCAT
TAGTCGCCGCCGGCTACCGGGGTGATGCTGTCAAAACGGCTGCCGCATTCGTATATGACCCGCCATTTCTTCTGC
GTGGATCGGTGGGCCACCCTGGCAGACGTGGCCGCCTATACAAAACCGGAGATATTGTTCGGTATAACTCCAACG
GTACTTTGACTTTCCTTGGCCGAAAGGATTCGCAAGTCAAGATCAACGGACAGCGAGTTGAATTCGGTGATATTG
AGTCTCACATAAACGGGGCGCTGCTACCGGACTTCAGTGAAGGTCAAGCTTTAGTCGAGTTTGTAACACCGCAAG
GAAGCTCACGTCCAATGCTTGTAGCTTTTGTTTACTTCGGACCTAGTGTCACTGAGGGCATGGATGAGGCCGATC
TGCTAAGCCTAGCCAAGCGCACAGCCATATCGCTGGATGAGAGTCTTGCTGCTCGAATCCCTGCATTCATGATAC
CATCCGCTTATATTCCATTGCAGAAAATTCCTGTCACAGCGACAGGCAAGACAGACCGCCGTCGTTTACGCGAGA
TGGCCAAAGATGTTACCTGGGACCAGCTCATTTCAGCTGACTCCCACGGTCCTGATCGTTGTCAACCTGGCACAG
AGATGGAGATACAGCTGCAGATCCTATGGGGGACTGTGCTAGGAGTTGAAAGTAGTTTGATCGGTGCACACGACA
ACTTCATGCGCGTCGGTGGTGATTCCGTGGGCGCAATACGCTTAGCGAGTTCTGCCCGGGAACTTGGTTTCACGC
TAAACGTGGCTGATATTCTCAAGAACCCGAAACTAAGTGATATGGCAAAACTTATGATACGAACAGAGCCGTCGC
AGGATATTTCAATCAAGGAATTCTCTCTCCTCAAACCTGGCTCTGATGTCGACTGGGCTGTTGCAGAAACATCCG
CTTTATGTGGTGTGGACGGTAACCAAGTCGAAGACTTGTATCCTTGCACACCCCTGCAAGAGGGCTTGCTGGCGC
TGACAACAAAGCGCCCCGGCGACTACATCATCCGGTGCATTTTGGAACTGAAGAGATCAACAGACGTCAAAAAGT
TCTGCGCCGCTTGGGAGGCGGTGTTGGAGAGCACCCCAATACTACGAACTCGGATCGTAGACATCGCAGAACAAG
GTTTGATGCAAGCTGTCATCAAACAACCAGCACAGTGGACATCGGCAGAAACCTCCAGTTTGGTAGACTTCGTGG
CTGCTGATAATGAGAAGACAACTGGTCTGGGTATGCCCTTGGTGCGATTCGGACTAGTGCAAGAGACGAACAAAC
ACTTTTTTGTTTTGACTCTGCATCATGCAGTATATGATGGCTGGGCGCTGAATCTGGTCTTCGAAAAGCTCGAAA
ATTTTTATGCTGGGTCTTCCAGGCATGAAAGCCCGGATTTCAGACACTTCGTCAAGCACATTTCAAGTCTCGACA
ACGACGCGGCTGCCAAGTTTTGGAAAGACCAACTCCAAGGCTCAGAGGCACCCACTTTCCCCTCCTTACCAACTG
CCACGTTCGTGCCCAAGTCTGAAAAGACCATTTTGCACACAGTTGAAGAGTTGCAGTGGCCCAAGACGAATGTCA
CTGCTTTTACGTTGGTGCGTGCGGCACTGTCACTTTTAACGGCGGCCTACACCAATTCAGAAGACGTTTGCTTTG
GCGTGACTTCCAACGGTCGGCAGGTTGGGCTCCCTGGAGTAGAAAGAATGATAGGTCCGACTATTGCGACAGTGC
CAGTTCGTGTTCGCATTGACCGCGAGCAGCGTCTCCAAGCCTTCCTCACACAGATGCAGCATCAGTCCATTGACA
TGATAGCGTTTGAACAATTTGGTCTGCAGCAAATACGGAAGTCAAGTCCTGACGCCGAACGGGCCTGTAACTTCC
AGTCACTTCTCATTGTCCAGCCGGCAGAAGAGACAGCCCAGTGGCAGAGCGATATAATTGCCCGTGATATCGGAG
AAGGAGCTGATGATCCTATGGGCATTCAAGAAATTGGAACATATGCCCTTACTCTCGAATGCCATCTCGGACCCG
ACAGTTTGCTCATAAAGGCCAACTTTGATTCCAATGTAATCGATGAACTACAGGTCAAGCGATTTACAAAGCAGT
TTGAGCACGTGCTACGTCAAATATGCTGCTCTGGTAGTGGCCTTGTCGTTTCTGATATTGATACCACCAGCAGAC
AAGACATGGAAGATATTTGGAAGTGGAATGCCGTAGTCCCCCAGTCAGTCAACACGCCTGTTCATGAGCTCATCT
CCTCTGTGGCACGCAGACTGCCGCATGTCCAAGCTGTATGCGCATGGGACGGCAACTGGACTTACCGTCAACTGG
ATGACCTGTCAAATTATGTTGCGCACCACCTCGTCGGCCTTGGTGTTGGCTCTCAGGACATCGTACCGCTGTTGT
TCGAGAAGTCCAAGTGGATGCCGATCGCGATGCTTGGTGTCATGAAAGCAGGGGCTGCATCGGTGGCTGTCGATA
CCAGTCAGCCCAAAGACCGACTTCGCATGATTATCGACCAGGCAAATCCCACGGTCGCGCTAAGCTCAGCTGATA
AGTTGCCTCTTGTCCGGAGTCTGACAAAGGCGCAAAGCTTCGTTGTCAATGGCCAAGCTATTGACTGCTTATTAA
AACCTAGCCTTAATGCTACACTTCCAGTTGTCGATCCGTCCAGCAGACTGTATTTGGTCTTCACCTCTGGTAGTA
CGGGTGTCCCGAAGGGTGTTATAATTCGACATTGCAATTTTGCCAGTGCAATTAAACACCAGAAAGAAGTTCAAG
GCATCCTTCCAACCTCGCGTGTCTATGACTTTGCTTCATATGCATTTGACGTCGCATGGGCCAATGCGCTACTGA
CCTTTGAGAGCGGCGCTTGTCTCTGTATCCCATCCGATGCTGAGAGAAAGAATGATCTAAACGGTTCGATTGCGC
GACTGAAGCCAACTCACGCTGATCTTACGCCTTCGGCAGCACTAGTCCTGTCCAAAGAGTCACTTCAGCAGCTTG
ATACCCTCACTTTAGGTGGCGAACGTCTCCTAGCGGAGTACGCAACAAAGTGGTCCCAGTTTGTGACAGTTAAAA
ACTCATACGGACCAAGCGAGTGCACTCCAACTGCCACATTTACCGAGGCAATTGGGCGTGGATACGATCTTGGTG
CTAGCATTGGTAAGCCTGCTGGTCTCAACACTTGGGTGGTTGATCCTGTGACGGGGCAGTCGCTCGTTCCCATTG
GAGGCGTCGGCGAGCTGTTCTTGGAGGGGCCGCTTGTCGGTGCTGGCTATCTTAATGATGCAGAGAAAACGAATG
CTGCTTTTATCCATGATCCACCATTTTTGCTCCGCGGCAACGTTGTCGCGCAACCTGGACGACGCGGCACGCTGT
ACAAGACGGGTGACATTGTGCGATACAACTCAGATGGCAGTCTCACTTTTGTTTGTCGGAAAGATACACAAGTCA
AGATCAATGGCCAGAGAGTAGAGCTTGCTGAGATTGAGAGTCATATAGCTCTATACACAGCGACCCGACAAGTGG
CGACCCTATTGCCTAGCACTGGCCTCTGTGCAAACAAGCTGGTAGCTATGATCAGCCTCACAGATGTGAACTATG
ATGTTAGCGAGGACCTCGCCGAAAACAAGATTGAGCTGGCATCTTCGGAACATGACCAACTCATCAATGAGCACA
TCGAGGCCCTTCAATCGTTATTGCGCGAGTCTTTGCCGCAGTACATGATTCCATCTCTGTGGGTGGTCTTGTACA
ACCTCCCTATGACAGCATCGGGAAAGCAAGACAATAAGGCACTCAAATCCTGGCTGGAAAATATGGATGAAACGC
TCTTTTCTAAAATCAACAATGCGAACGGTAGCGACATTATCCGAAAACCAGACACAGAAGACGAAAGAGCTCTCA
TCCAGAAATGCAGTATCGTCCTTAATATGCCCGTCGACAAGATCAATCTCGACAAATCTTTTATTGCGAATGGTG
GAGATTCCATTTCCGCCATGAGGCTTGCATCCCACTACAGAACTGCGGGAATTTCCATCTCAGTCTCAACACTCC
TTCAAAGTAAAACCCTCGCGGATTTCGCAGCATTTTCGGGCGCAACAGCCATTACCGGAGTCAGTCAGGAAGAGC
ATACTGACGTTCCTTTCGAACTATCACCCATCCAGCAGTGGTTCTTTGACCAATCGCCATTTATGAGCCAGCAGA
AGCATGACAGATTCTACAACCAAGGATTCTATGTGAGACTCAGGCGCACAGTGGGAATCAATGATCTAGAATCAG
CCTTTCTTTCTCTGGTCAATCGGCACGCGATGTTACGCTCGCGATTCCAGCATCATGGGGGCAAATGGAAGCAAA
TAATCCCCAGTCACGGCAAACGAGCTCTTCATTTGAACGTATCGCAGCACCTGTCCATGAGCGAGATTGCATTGT
TAGCTCAAGAGCGGCACCGACAGATTGACATAGAGCAAGGTCCTGTCTTCTCGGTTGATATTTGCTTACTAGGCC
AGCAGCAGCATCTGGTCATGATAGCCCATCATTTGGTTACCGATTTGGTCTCCTGGCGGATTATCTTAGATGATC
TGGAGACTATTCTCAACGGCCATTCCCTAACGGCCGCTCTATCCTTCCAAGTGTGGAGCAGGCTGCAAGCTGAGC
GGGCTGTATCTTCCACTTTGAAGCCTCACAACTTGCTGTCGACTGACGGCGTCCATAACAATCTCAAGTTTTGGA
AGTATACGCACGACACGCCCAACTGCTTGGCAGACCACAGGCTCCGATCGGTCACCATTGATCGAGAAACTACGG
CTGTACTACTGGGCGAGGCAAACAAAGCCATGAATACAGAGCCAGTAGAGATCCTTTTATCAGCTGTTTGGGATG
CATTCTTTCGGACGTTTTCCCAGCGCAACAGCCTGACCATATTCAACGAAGGTCATGGTCGCGAAGCTTGGTCCG
ATGAAATTGACTTGTCGAGCACTGTTGGATGGTTTACCACCCTCAGTCCCATCAACATCTATAGAAATAATGCCA
CCAGCGAGACCGACATGGTGCGGCTCGTCAAGGATGCCCGCCGCAGCCTTCCCGCGAACGGCTGGTCTTACTTTA
CCTCCCGATATCTGAACCCCGACGGGCAAAGAGCTTTTGAAAGCCATAACACAGTGTCTGAAGTTGTTTTCAATT
ATCATGGCCAATTCCAACAACTAGAAAGTCATCAAGCCCTTTTTGAAGACATTGATCTTGTCGGTGTACGTGAGC
AAGGTCGCTCAATATCTGCAGGGTCTTTGTTTAACATCGAGGTTGCCATTGAAGCAATGCAAGCGCACTTTGAAT
TCTCCGTTAATCAAAATATCGCTCATCAGAGCTTGATTAACCAGTGGATTGACCAGATTCAACCCTCTTTGGAAA
GGATTTGCCTCGTCCTTCTCGAGGCCAACCCAACGCATACGCTGTGTGACTTCAAGTTCATCAGTCTCGACTACC
AGCGCCTTGACGATCTTACCAGTCGGCTACTTCCGGAGATCGAGTCAATCAACCAATCAACTGTTGAGGAGATTT
TCTCGTGCTCTCCGATTGTCGATGGAATGCTCCTCAGTCAGATAAAGCAGCCCGAATCATACAAGACACTTCAGC
GATACGAGGTGTTGTCATCTCATGACCATCCTATCTGTCTCGACACCCTCAAAATTGCTTGGCAAAAGGTGATTT
CTCGCCAGCCTGCCCTGAGGACAGTTTTCATCGCTGGCCTTGACGGATCTACCGCCTTTTACCAGGCCCTTCTCA
AAGAGTGCTCCGGGGATGTTATCGTTGTTGAGGCTAAAACTGAAGAGGAAGCCCTGAAAGCCTTTTCCTCGCTTC
CGAAAGTCGATTACCAACAGGCCAAACCTCCTCATCGCCTCACTCTTTGTCAAACGCCGGATGACAAAGTCTTTT
GTCAGATTGAAATGAGCCATACTATTACTGATGGTGCCTCTTCCAACATTTTGATTAAGGATCTGATTGACGCTT
ATGGTGATAGGCTGTCGTCAACAGACCTTGACAAAACAACACGCGAATTTGCTAGCCACTTGCTGGCTAAGCCAC
AGTCCCAAAAGATTTCGTATTGGAACACAAAACTCAAGGGCCTTGAACCTTGCCGCTTTCCATCCCTATCGAGCA
TGTCTCGGGAGAAGCACGAGTGTAGCTCGGAGATTGGAGTTTTTGTCGAAGACAAGATGTTTGCGCAGATTCAAG
ACTTCTGTAGCATAAACCAGGTCACGCCAGCAAGTCTCCTCAAAAGCGCCTGGGCTTTGACACTCTCGACCTACG
TACAAAATCAATCTGTCTGCTTTGGCTATCTGGCATCTGGTCGAGACCTCCCAATCGCCGGGATGGACGAATCTG
TCGGCGCTTACACTAATATCATGGTCTGCCGTGCCGATTTGGATGGGCAACAGCCTGGTGTGGCACTCGTGCGAC
AACTTCAGGATCAATTAATGCAGGACTTGAGCTTCCAACATATATCGCTTGCTAGCATTCAACATGAGCTTGGAC
TGGCGTCCGATCAGCAGCTTTTCAACTCTATTGTCTCTTTTCAGAGGTCAGGAGACGATAATGAACAATCAGCAG
AGGAGGGTAAACTTCGATTCAAGAATATTGATGGTTTGGACCCAACAGAAGTCAGTGGATTGTTGAGCATGAGAG
TGTATACATCTGGACTAATGTTTTTATAGTACGACATCGTATTGGGTATCAACCAAGGAACCAGGTCCATCGAAA
TTGACCTTGAATTCTCACACAGCTGTCTCACTAGTAATCAGGCAAAACGCATTCTCGAGCATCTGGAGTCAAACA
TTGCCGCTATTCTTCACAATGAGCCACCTGCTCTGATCAGCCCCCAAGATGAGCAAGATATTTGGAGCTGGAACT
CCACTGTTCCTGACATGGTCAACATCTGCGTTCACGATCTGATCTCCAAGATAGTATTCCGCCAGCCTGATGCAC
CAGCTGTTTGCTCATGGGACGGCGATTTCACCTATGCGGAGCTGGATAATTTTGCAACACGCCTTGCCAATAGTC
TCAGCAAGATGGGCATCGGAAGAGGCAGCATCGTCCCGCTATGTTTTGAAAAATCAAAATGGACACCAGTTGCCA
TGCTAGCAGTTATGAAAACAGGTGCAGCCTCTGTTACGATGGATACTAGCCAGCCTGAAGAACGGCTCCAGTCTA
TTGTTGCACAGGTGGATGCTAAACTTGTGATCTCTTCGACATTGAAGGTTGAGCTAGCAGCCAGGCTCACAACGG
CTCCCGTCTTGGCTATAGACAAAGCCAGCATGAAGGCGATGGCTGATGATACGCCGCTGGCTGCAGTCGATCCCG
CAAACAGTATTTACATTGTCTTCACATCAGGGAGCACTGGCACGCCAAAAGGTGTCATCATCACTCATACTAACT
ACAGCAGCGCCATCAAGCATCAGCAGAGTGAACACGGCTTCAAGCCATCCTCTAGGGTCTTTGACTTTGCCTCTT
ATGCGTTCGATGTCAGCTGGTCCAATTTCTTGCACACCTTGACCATTGGGGCCTGCTTATGCATACCTTCTGATG
ATGATCGTAAAAATGACCCGGCGGGCGCAATTGACCGCTTACGGTGTACACACGTTGATATGACCCCCTCGGCCG
CAAGCGTCTTACCTGCCAGTACGTTGGCTAAATTGGATACCATTGTTCTGGGAGGCGAGAAGCTGTCGCTTGAAT
ATGCCCAACGCTGGTCCGCCCTGACAAGCGTGCGTAATCCGTACGGGCCTTCTGAATGCACACCGACGTCGACAA
TTACGGAGATCAATTCTGCGGAAATAAGCAAGGGCAAAGTGAGCATCGGCAAAGGAGTGGGACTCAATACTTGGA
TTGTTGATCCTGCCACTGCACAACATTTAATGCCGATTGGCATCCCTGGGGAGTTATTACTCGAAGGTCCGCTTG
TTGGTGCTGGCTATCTTGGAGACCCTGTCAAAACCGCTTCAGCATTTATTGAAGACCCAGAATTCCTAGTCAAAG
GCGCTGGTCCAGGAATTCCAGGCCGCCGTGGTCGTCTGTACAGGACGGGCGATCTAGTCACCTATAATACCGATG
GTAGCTTGTCATTTGTGGGCCGAAGGGACTCTCAAATCAAAATAAACGGGCAACGCGTCGAATTAGGCGACATCG
AGTCGCACGTTTCTGCAAACCTGGTGAGTCATGGCAGTGCTCAGGTTGCGGTCGAGGTTGTGTCACCCCAAGCTA
GCTCCAACAACATACTTGTCGCCTTCGTGAGCTTTGACGACCTGAATTATATCAACCTGAATGATGAAAAGCTTC
TTGCCCGCACGAAAGCGGCGACCGAGGGAATTAGGGAGAAACTCGCGACACAAATCCCATCTTATATGATTCCTT
CGGTCTACATCCCTGTTACTGTTTTTCCGACAACAGCTACTGGGAAGACTGATCGGCGCCGATTACGTGAAATGG
CCTCAAGCCTCACCCTGGAGCAGCTTACCTCAATCAACCAAGCTCAACAGCAATATCAACCCCCCACTACTCCTT
TGGAAGTGGCACTTCGGGAGCTCTGGATCTCAGTTCTCAAATTAGGATCGCGAAAGATTAGCACTACAAACAACT
TCTTCGAACTTGGTGGAGATTCCATCGGTGCTATGAGGCTGGTAGGCGCGGCCCGTGACCACGGACTATCGCTTT
CCGTTGTAGATATTTTCAAGCATCCTAAGTTCAGCGAAATGGCTGCTTTGCTCCGTTCTGTGGATAAGCCGCAGT
CGGAAGAGCCACGGGTATTTCAACCCACTTCGCTTCTGTCCAAAGATCACAACAAAGACCAGATACTCTCTCGAC
TCTCTGACTTTGGTATTGACTGGGAAAATGTTGAAGACATCCTCCCTGTCACAGATCATCAAGCTCGTTCCATCG
CGATGACTCACTCTGCGTCCCGCGACTTGCTACTCTATCACACTTTAGATAGCAAGGGCGTGCCAAATATGCGCA
AGATGCGAGCAGTGTGCAATGAGCTCGTCAATAGATATGATCTCTTGCGAACCCTTTTCATCGCACATAAAGACA
GCTTCTTGCAGGTCGTGCTGAAGGCCTTTCCTGTGGATATAACCGTCTTGAGAATCGAGAATGCCAGCCTAGAAG
AATGCACAGAAGAGCTACGATTACGCGACAGGGACGATGAGCTCCGTTATGGCTCGCTCCTAACAAAGATTGCTA
TTTTGCATCAAATTCGCGACAACGAATACCGTCTTGTGGTCCGCATTTCCCATGCTCAACATGACGGAATGAGCT
TGATGAAAATGTGGAACGCATTTGAAGAAATGTACGGTGACGGGAGTGACGACTCATTCCACATTCCTTCGGACA
CTAGCTTCCAAGAAAAGTCCAAGGCTAGTTTCTCCAACTACATGCATGCCGTGGCTGGTACAAACCGGGAGCAAG
CTAAGTCTCACTGGCGCAGACTCCTCAAGGGCTCCAGTATGACGAACCTCAAGCCCCATGCTTCATATGCCCTGA
CCTTTGGCGAAGGACCATGTGTCGCCAGACATGTTCCTAAGAGCATTGCTCAAGGTACTGGATTTACATTTCCTA
CTGTACTGAAGGCTGCTTGGGCGTACGTTCTGGCAAAACACCTTGCCAAAGACGACGTGGTTTTCTGTAACCTCA
CTCACGGTCGGGGCTTGCCCGGGACACAAGATGTCTTTGGAGACTGCGTGAACATCATTCCTACTCGAGTATCCT
TTACCGACGGATGGACTGTTCGCGACCTTCTCAGTGCATTGAACACGCAACAGATTGCGAGCATGGAGCATGAGA
ATATAGGCACACGCGAAATTGTCCGTGACTGTACTACATGGCCGAAGTGGACATATGCAGGATCCATCGTTTATC
ACCATGACTTTGACGATGGAGAACATATTGCTCATAACCGCAGTATGCACGTTGAGCAGGAGCTAGATCTGTCTC
ACGGCAAAGTGGACATGACCGACGTTCATATCACTTCTAAGCCTGATAACAACATGTTCCGAATTGAGCTGGACT
TCGCACATGGCGTAATATCTGAGCGTGACGCTGAACTGCTGGCTGCGAAACTGACGGAATCTATCATCGTTTTCT
GCAATGTCATGGACCAGCCTTTGTTATCTCCCGACCAGATCAGATATCTGCGGACAACCACATTGCTGCCCTCAG
AGGAGCCTCTCAGTGCAACCCCAACAAATGAACAGTTAATGGTTGCTAGCATTAGCCCGACTGAAATGCAATGGG
CGCTTGAGAGTGCGTGGAGGGACACTTTCAATTGCCGCCTTAGTCCTGAGGTGAAAGCGGGCAAGACAATTTTTG
ATCTTGGTGGTGACTTGGTAAGCGCTAGTCTGATATCAGCTCACATGGAGAGGCAAGGATATGTTCTTAGTGTTG
AGGATGTCTTGGGGAATCCGACTTGGTTCTTGCAACTGACGCTGCTGACGAAGCGCTCCCTTCGGGATGTTGATG
TCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail