Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9303.t1
Gene name
Locationscaffold_082:124086..127644
Strand-
Gene length (bp)3558
Transcript length (bp)2448
Coding sequence length (bp)2448
Protein length (aa) 816

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.6E-29 90 470
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 4.6E-11 644 776
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 2.1E-08 511 593

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 118 140 22
3 153 175 22
4 210 232 22
5 319 341 22
6 356 378 22
7 398 420 22
8 430 452 22
9 457 479 22
10 489 511 22
11 635 653 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9303.t1
MASWLIDTPLGELIRVSIGSRWLPFPEEQEDWILRNAGFADGEKNEQPLQQQLCPLPAQLVGWYGIDDPANPQNW
SPVKKARVYLTINYCACTVYMSSSIYTSSQDAVEEIFHTSSTVASLGLALFVLAYGIGPLLFAPISEVHSIGRNI
PYIISLAIFIIISVVTATASNLGGLLTLRFLQGFFGSPALATGGASLSDVSDTVWKPFALYTWAFFSFVGPSIGP
VLSTVAVERLGWRWSLWEIVFLTTPAFLSTEQLILPETSAPNILYRRAQRLNRRFPGREFHLAEDSTVPDRRGLQ
AMLVQALVTPWQVHLLSPAIMFSSLYCGLVYGIFYTFFETFPIAYTEIHHMSSVSTALVYLSTMIAVILVGIPYL
IYIYCVVNPIVARGERITPEWRLIPAVIASFIIPAGLFLFSWTVRTDIHWMVPTVGVVFATGGMCIVLQSIFVYI
TLAYTQYAASILGGNGFIKSCVACAAILWSAPLYDDMGLPVGVSILGALCVLGVDGCFALGEPDLPQTNLIVGHE
SLGTIVLSPSDSTLLQTTVATRFLVSTCGTCSYCIRHLPESCVHRTTYPALTGTMQEYITVPYRHLQPLPQDYVT
HLRADGGMALYVAAFCSGAAALKSLRTAAPRPGDVVLVSGVLGAIGHLVGMIAKKVYGARVVGVDLGWKWNRLNA
VPQMIEAISGDGCVGFDLREEEVTFTPAGRADSVIVCASSAAAFQRLEDLVRDGGSIIIVGAPRGPCMVQMPLRS
LLDRQLRIQGSLMGTWEESLQVMQWIRDCTITPYVHQVDLADAGRQLSDCVDCKTFGKGIIRIYP*
Coding >Ani_SJS100_1|g9303.t1
ATGGCATCTTGGTTGATTGACACCCCGCTGGGAGAGCTCATCCGGGTATCTATAGGATCGCGATGGTTACCCTTC
CCCGAAGAACAAGAGGACTGGATCCTCAGAAATGCTGGCTTTGCCGACGGTGAGAAGAACGAGCAGCCATTGCAG
CAACAACTGTGCCCCCTTCCCGCCCAGCTCGTGGGCTGGTATGGAATCGATGACCCGGCCAATCCCCAAAATTGG
TCGCCCGTGAAGAAGGCTCGGGTCTATTTGACCATAAACTATTGCGCCTGCACGGTTTATATGTCCTCCAGCATT
TATACTTCGTCCCAGGATGCGGTAGAAGAGATCTTTCATACTTCTAGCACTGTGGCCAGTCTTGGTCTCGCCTTG
TTTGTGCTGGCATATGGAATTGGTCCCCTCTTATTCGCACCTATCTCCGAGGTACATTCAATTGGACGTAATATT
CCATATATTATTTCTCTGGCGATCTTCATCATCATATCTGTGGTCACGGCCACGGCATCAAATTTGGGTGGCCTG
CTAACGTTGCGCTTCTTGCAAGGCTTCTTCGGCTCGCCTGCCCTCGCAACCGGGGGTGCATCGTTGTCAGATGTG
AGCGATACAGTCTGGAAGCCGTTCGCTCTGTACACTTGGGCCTTCTTCTCTTTCGTGGGACCGTCGATCGGGCCC
GTGCTTAGTACGGTGGCCGTAGAAAGGCTCGGATGGAGGTGGAGTCTGTGGGAGATTGTCTTTCTCACCACCCCG
GCATTCCTGTCCACCGAGCAGCTCATTCTTCCCGAAACATCTGCCCCAAACATCCTGTACCGCCGTGCTCAACGC
CTGAATCGGCGCTTCCCTGGGCGTGAGTTTCATCTGGCCGAGGACAGCACAGTGCCCGACCGTCGGGGGCTGCAG
GCCATGCTTGTGCAGGCCCTGGTCACTCCGTGGCAAGTGCATCTGCTCTCTCCGGCGATCATGTTCAGCAGTCTC
TACTGCGGTCTCGTATATGGCATTTTCTACACGTTTTTCGAGACCTTTCCGATTGCCTACACTGAGATCCATCAC
ATGAGCTCGGTCTCTACGGCGCTCGTGTACTTGTCAACCATGATCGCGGTTATCCTGGTGGGTATTCCCTACCTT
ATCTACATCTACTGTGTGGTCAATCCGATCGTCGCGCGCGGCGAGCGTATTACCCCCGAATGGCGGCTAATCCCG
GCGGTGATCGCGTCGTTTATTATCCCGGCGGGTCTTTTCCTCTTCTCCTGGACGGTGCGGACAGACATCCACTGG
ATGGTCCCTACTGTTGGGGTGGTCTTCGCCACAGGTGGCATGTGCATTGTGCTACAGAGCATTTTTGTGTACATT
ACACTGGCATACACACAGTATGCGGCCTCAATCCTTGGGGGCAATGGTTTTATAAAATCGTGTGTGGCATGCGCC
GCCATCTTGTGGTCTGCTCCTCTATATGATGACATGGGGCTTCCCGTTGGTGTGTCAATTCTGGGAGCGTTGTGT
GTCCTGGGAGTGGACGGCTGCTTCGCCCTCGGTGAACCAGACCTTCCACAGACCAACTTGATTGTCGGCCACGAA
TCCCTCGGCACCATCGTTCTCTCCCCCTCTGACTCGACCCTCCTACAGACCACCGTCGCTACCCGATTCCTTGTA
TCCACCTGCGGCACCTGCAGCTACTGCATTCGTCACCTCCCCGAATCTTGTGTGCACCGCACAACCTATCCCGCC
CTCACGGGTACCATGCAGGAGTACATCACTGTCCCCTATCGACACCTCCAACCACTCCCACAAGACTACGTGACT
CATCTCCGGGCCGACGGTGGTATGGCACTCTATGTCGCAGCGTTCTGCTCTGGTGCCGCCGCGCTGAAGAGCCTG
CGCACCGCGGCACCACGGCCCGGCGATGTAGTGCTGGTATCTGGGGTGCTCGGGGCGATTGGCCATCTAGTCGGC
ATGATCGCCAAGAAGGTGTATGGGGCCCGGGTGGTCGGGGTAGATTTAGGGTGGAAGTGGAATCGCCTGAATGCG
GTGCCGCAGATGATCGAGGCGATCAGTGGGGATGGGTGCGTGGGGTTTGATCTCCGAGAGGAAGAGGTGACGTTC
ACCCCGGCTGGACGGGCAGATTCGGTGATAGTGTGTGCCAGTTCAGCGGCGGCTTTCCAGCGGCTTGAGGATCTG
GTACGGGATGGGGGAAGTATCATTATTGTTGGAGCACCCCGCGGACCCTGTATGGTACAGATGCCCCTGCGGAGT
TTGCTGGACCGCCAGCTGCGCATTCAGGGTTCCCTGATGGGCACCTGGGAGGAGTCCCTGCAGGTCATGCAGTGG
ATCCGCGACTGCACCATCACCCCGTACGTGCACCAGGTGGACCTGGCCGATGCAGGACGACAGCTTTCTGATTGT
GTGGATTGCAAGACATTCGGAAAGGGAATCATACGTATTTATCCTTGA
Transcript >Ani_SJS100_1|g9303.t1
ATGGCATCTTGGTTGATTGACACCCCGCTGGGAGAGCTCATCCGGGTATCTATAGGATCGCGATGGTTACCCTTC
CCCGAAGAACAAGAGGACTGGATCCTCAGAAATGCTGGCTTTGCCGACGGTGAGAAGAACGAGCAGCCATTGCAG
CAACAACTGTGCCCCCTTCCCGCCCAGCTCGTGGGCTGGTATGGAATCGATGACCCGGCCAATCCCCAAAATTGG
TCGCCCGTGAAGAAGGCTCGGGTCTATTTGACCATAAACTATTGCGCCTGCACGGTTTATATGTCCTCCAGCATT
TATACTTCGTCCCAGGATGCGGTAGAAGAGATCTTTCATACTTCTAGCACTGTGGCCAGTCTTGGTCTCGCCTTG
TTTGTGCTGGCATATGGAATTGGTCCCCTCTTATTCGCACCTATCTCCGAGGTACATTCAATTGGACGTAATATT
CCATATATTATTTCTCTGGCGATCTTCATCATCATATCTGTGGTCACGGCCACGGCATCAAATTTGGGTGGCCTG
CTAACGTTGCGCTTCTTGCAAGGCTTCTTCGGCTCGCCTGCCCTCGCAACCGGGGGTGCATCGTTGTCAGATGTG
AGCGATACAGTCTGGAAGCCGTTCGCTCTGTACACTTGGGCCTTCTTCTCTTTCGTGGGACCGTCGATCGGGCCC
GTGCTTAGTACGGTGGCCGTAGAAAGGCTCGGATGGAGGTGGAGTCTGTGGGAGATTGTCTTTCTCACCACCCCG
GCATTCCTGTCCACCGAGCAGCTCATTCTTCCCGAAACATCTGCCCCAAACATCCTGTACCGCCGTGCTCAACGC
CTGAATCGGCGCTTCCCTGGGCGTGAGTTTCATCTGGCCGAGGACAGCACAGTGCCCGACCGTCGGGGGCTGCAG
GCCATGCTTGTGCAGGCCCTGGTCACTCCGTGGCAAGTGCATCTGCTCTCTCCGGCGATCATGTTCAGCAGTCTC
TACTGCGGTCTCGTATATGGCATTTTCTACACGTTTTTCGAGACCTTTCCGATTGCCTACACTGAGATCCATCAC
ATGAGCTCGGTCTCTACGGCGCTCGTGTACTTGTCAACCATGATCGCGGTTATCCTGGTGGGTATTCCCTACCTT
ATCTACATCTACTGTGTGGTCAATCCGATCGTCGCGCGCGGCGAGCGTATTACCCCCGAATGGCGGCTAATCCCG
GCGGTGATCGCGTCGTTTATTATCCCGGCGGGTCTTTTCCTCTTCTCCTGGACGGTGCGGACAGACATCCACTGG
ATGGTCCCTACTGTTGGGGTGGTCTTCGCCACAGGTGGCATGTGCATTGTGCTACAGAGCATTTTTGTGTACATT
ACACTGGCATACACACAGTATGCGGCCTCAATCCTTGGGGGCAATGGTTTTATAAAATCGTGTGTGGCATGCGCC
GCCATCTTGTGGTCTGCTCCTCTATATGATGACATGGGGCTTCCCGTTGGTGTGTCAATTCTGGGAGCGTTGTGT
GTCCTGGGAGTGGACGGCTGCTTCGCCCTCGGTGAACCAGACCTTCCACAGACCAACTTGATTGTCGGCCACGAA
TCCCTCGGCACCATCGTTCTCTCCCCCTCTGACTCGACCCTCCTACAGACCACCGTCGCTACCCGATTCCTTGTA
TCCACCTGCGGCACCTGCAGCTACTGCATTCGTCACCTCCCCGAATCTTGTGTGCACCGCACAACCTATCCCGCC
CTCACGGGTACCATGCAGGAGTACATCACTGTCCCCTATCGACACCTCCAACCACTCCCACAAGACTACGTGACT
CATCTCCGGGCCGACGGTGGTATGGCACTCTATGTCGCAGCGTTCTGCTCTGGTGCCGCCGCGCTGAAGAGCCTG
CGCACCGCGGCACCACGGCCCGGCGATGTAGTGCTGGTATCTGGGGTGCTCGGGGCGATTGGCCATCTAGTCGGC
ATGATCGCCAAGAAGGTGTATGGGGCCCGGGTGGTCGGGGTAGATTTAGGGTGGAAGTGGAATCGCCTGAATGCG
GTGCCGCAGATGATCGAGGCGATCAGTGGGGATGGGTGCGTGGGGTTTGATCTCCGAGAGGAAGAGGTGACGTTC
ACCCCGGCTGGACGGGCAGATTCGGTGATAGTGTGTGCCAGTTCAGCGGCGGCTTTCCAGCGGCTTGAGGATCTG
GTACGGGATGGGGGAAGTATCATTATTGTTGGAGCACCCCGCGGACCCTGTATGGTACAGATGCCCCTGCGGAGT
TTGCTGGACCGCCAGCTGCGCATTCAGGGTTCCCTGATGGGCACCTGGGAGGAGTCCCTGCAGGTCATGCAGTGG
ATCCGCGACTGCACCATCACCCCGTACGTGCACCAGGTGGACCTGGCCGATGCAGGACGACAGCTTTCTGATTGT
GTGGATTGCAAGACATTCGGAAAGGGAATCATACGTATTTATCCTTGA
Gene >Ani_SJS100_1|g9303.t1
ATGGCATCTTGGTTGATTGACACCCCGCTGGGAGAGCTCATCCGGGTATCTATAGGATCGCGATGGTTACCCTTC
CCCGAAGAACAAGAGGACTGGATCCTCAGAAATGCTGGCTTTGCCGACGGTGAGAAGAACGAGCAGCCATTGCAG
CAACAACTGTGCCCCCTTCCCGCCCAGCTCGTGGGCTGGTATGGAATCGATGACCCGGCCAATCCCCAAAATTGG
TCGCCCGTGAAGAAGGCTCGGGTCTATTTGACCATAAACTATTGCGCCTGCACGGTTTATATGTCCTCCAGCATT
TATACTTCGTCCCAGGATGCGGTAGAAGAGATCTTTCATACTTCTAGCACTGTGGCCAGTCTTGGTCTCGCCTTG
TTTGTGCTGGCATATGGAATTGGTCCCCTCTTATTCGCACCTATCTCCGAGGTACATTCAATTGGACGTAATATT
CCATATATTATTTCTCTGGCGATCTTCATCATCATATCTGTGGTCACGGCCACGGCATCAAATTTGGGTGGCCTG
CTAACGTTGCGCTTCTTGCAAGGCTTCTTCGGCTCGCCTGCCCTCGCAACCGGGGGTGCATCGTTGTCAGATGTG
AGCGATACAGTCTGGAAGCCGTTCGCTCTGTACACTTGGGCCTTCTTCTCTTTCGTGGGACCGTCGATCGGGCCC
GTGCTTAGTACGGTGGCCGTAGAAAGGCTCGGATGGAGGTGGAGTCTGTGGGAGATTGTCTTTCTCACCACCCCG
GCATTCCTGTTGATGGCAAGTGCCGCCTAACCAACCCCCCCCTTTCCGTCTCTCTCCCTCTCTCCGGGCGGAGAT
TATAGGCCATATTGACTGACTGGCAGGTCCACCGAGCAGCTCATTCTTCCCGAAACATCTGCCCCAAACATCCTG
TACCGCCGTGCTCAACGCCTGAATCGGCGCTTCCCTGGGCGTGAGTTTCATCTGGCCGAGGACAGCACAGTGCCC
GACCGTCGGGGGCTGCAGGCCATGCTTGTGCAGGCCCTGGTCACTCCGTGGCAAGTGCATCTGCTCTCTCCGGCG
ATCATGTTCAGCAGTCTCTACTGCGGTCTCGTATATGGCATTTTCTACACGTTTTTCGAGACCTTTCCGATTGCC
TACACTGAGATCCATCACATGAGCTCGGTCTCTACGGCGCTCGTGTACTTGTCAACCATGATCGCGGTTATCCTG
GTGGGTATTCCCTACCTTATCTACATCTACTGTGTGGTCAATCCGATCGTCGCGCGCGGCGAGCGTATTACCCCC
GAATGGCGGCTAATCCCGGCGGTGATCGCGTCGTTTATTATCCCGGCGGGTCTTTTCCTCTTCTCCTGGACGGTG
CGGACAGACATCCACTGGATGGTCCCTACTGTTGGGGTGGTCTTCGCCACAGGTGGCATGTGCATTGTGCTACAG
AGCATTTTTGTGTACATTACACTGGCATACACACAGTATGCGGCCTCAATCCTTGGGGGCAATGGTTTTATAAAA
TCGTGTGTGGCATGCGCCGCCATCTTGTGGTCTGCTCCTCTATATGATGACATGGGGCTTCCCGTTGGTGTGTCA
ATTCTGGGAGCGTTGTGTGTCCTGGGAGTGGTAGGCATCGTCTTGTTGTACAGGTTCGGAGGGATTCTCCGCGCA
AGGAGCCGGTTCGCACAGTGGAATGAGAAATAGAATATGGGGCGACTGGGAGCCACACGCATGATACAAGAATAC
CGGTCATGCTCACTTGCCAATGAAAAGAAACAACCTGACTATCATCAATGGTTTCGACTACTATATCAGAATTAC
GTAGCTGGTGCCGCGCTTTCATTATAGTTTGTAGCAATCTACCAAGCTTTGGATAATATATACTGGTGTAAACAA
TCTACCTCCGGAGTTCGATATAGCAGTTTGATAGTCACCTTGCGTCCCCTTGTGAACTTTGGCTGTTCGTACTAG
TGCTGCATACAACTCTGGCGACTGAGGAATATATATTCCGCCAGTTTGGTTTGAAGGCGGGCAAGGGACAGCTGG
TTCATGAATCGTCAAGGTACAAATCGCACGAGTAGGTACAAGTTTCTCCCACCCTTCATTCACTATCCTTTTCCT
GGTTTACAACCAACCCTATTAGACTTTAGACAATGACCGCCACTTTGCCCGTTCCACTGAAATTGGGTCTCCACA
AGCATCAGCCTCAGATGGAACCGATGGTGCTGGACGAGAAAAGGATCCCGCCTCGCCGTCAACAGCCATCTACAC
TGCCATCCCACCACAGTGGATACATCACCCGCCAAGTCGGGGGTGAATTAAACCTAGAGCACTGCACCGACCTTG
AAATCAGACCTCCGGGCCCCGGCGAAGTTGTCGTGAAACTTCTCTACTCAGGCATTTGTCGGACAGTGAGACTTC
CCGCTGCCTTCCATCAACGCATAGGGTATACAATGAAACTGAATTTATCCGTTGAAGGACGGCTGCTTCGCCCTC
GGTGAACCAGACCTTCCACAGACCAACTTGATTGTCGGCCACGAATCCCTCGGCACCATCGTTCTCTCCCCCTCT
GACTCGACCCTCCTACAGACCACCGTCGCTACCCGATTCCTTGTATCCACCTGCGGCACCTGCAGCTACTGCATT
CGTCACCTCCCCGAATCTTGTGTGCACCGCACAACCTATCCCGCCCTCACGGGTACCATGCAGGAGTACATCACT
GTCCCCTATCGACACCTCCAACCACTCCCACAAGACTACGTGACTCATCTCCGGGCCGACGGTGGTATGGCACTC
TATGTCGCAGCGTTCTGCTCTGGTGCCGCCGCGCTGAAGAGCCTGCGCACCGCGGCACCACGGCCCGGCGATGTA
GTGCTGGTATCTGGGGTGCTCGGGGCGATTGGCCATCTAGTCGGCATGATCGCCAAGAAGGTGTATGGGGCCCGG
GTGGTCGGGGTAGATTTAGGGTGGAAGTGGAATCGCCTGAATGCGGTGCCGCAGATGATCGAGGCGATCAGTGGG
GATGGGTGCGTGGGGTTTGATGTAAGTCAGGTGTGTGATGCGTTTGTCCCGGCCTGTGAATGTCCACTTGATCAG
TTATCGCAAGATCGTTTTCTACGGCAATTGGAGAGAGCATGTGCACAGCTCCGAGAGGAAGAGGTGACGTTCACC
CCGGCTGGACGGGCAGATTCGGTGATAGTGTGTGCCAGTTCAGCGGCGGCTTTCCAGCGGCTTGAGGATCTGGTA
CGGGATGGGGGAAGTATCATTATTGTTGGGTAAGTTTAGCTGCGCAATCCTGTTCAAAATGGATGAGTTCGTGGT
TCTGACGGTGAGACTAGAGCACCCCGCGGACCCTGTATGGTACAGATGCCCCTGCGGAGTTTGCTGGACCGCCAG
CTGCGCATTCAGGGTTCCCTGATGGGCACCTGGGAGGAGTCCCTGCAGGTCATGCAGTGGATCCGCGACTGCACC
ATCACCCCGTACGTGCACCAGGTGGACCTGGCCGATGCAGGACGACAGCTTTCTGATTGTGTGGATTGCAAGACA
TTCGGAAAGGGAATCATACGTATTTATCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail