Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9173.t1
Gene name
Locationscaffold_080:30909..33461
Strand-
Gene length (bp)2552
Transcript length (bp)2472
Coding sequence length (bp)2472
Protein length (aa) 824

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03473 MOSC MOSC domain 9.0E-34 667 817
PF03476 MOSC_N MOSC N-terminal beta barrel domain 4.0E-30 481 618
PF00266 Aminotran_5 Aminotransferase class-V 6.7E-25 29 448

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0030151 molybdenum ion binding Yes
GO:0070279 vitamin B6 binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0043169 cation binding No
GO:0019842 vitamin binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9173.t1
MSDRGKCQYPDDVDVIREREYPLLKDTTYLDHAGTTLYAKSLIESFSRDLTSNLYGNPHSMSAPSQLSTQRVDDI
RLRALRFFSADPEEFDLVFVANATAAIKLVADSFRESTPQGFWYGYHVDSHTSLVGARELAGIGSRCFVTDAEVE
SWISQLDTEPVQGPRLFAYPAQSNMNGRRFPRGWCGRIRESAKDTYTLLDVASLVSTSPFDLSDASAAPDFAVLS
FYKIFGFPDLGALIVRKSAGHIFDKRKFFGGGTVDMVLTQGTQWHAKKQSSIHERLEDGTLPFHNIIALGSAFDT
HERLFGSMDNISSHTRFLAKRLYDRMTTLRHYNGESVCHVYKPSHSDYTDPSTQGPILAFNLRSSQGAWIGKSEV
EKMASVRNIQIRSGTLCNPGGTAASLNWSGADMLRHFGAGMRCGDDHDIMDGRPTGILRVSLGAMSNLTDIDTFM
GFIEEFYVEKSPNVCALVPPLEANLTHRSGFHVESLSVYPIKSCGAFKVPDGKRWEIRREGLVWDREWCLIHQGT
GTALNQKRYPRMALIRPFIDLSHGVLRVTCGSIRSPSQKTLEIPLDRENSNLTTTSLCQNSSKPSTVCGDQVIVQ
AYSSPTVSAFFSDFLGVPCTLARFPPQSSTRLAEPRRGLGSRKSPLRPAMPGAFPQDTPTPEAERNPILLSNESP
ILLISRSSVNRLNETIKSSPTTTNSTGRKKAVAADVFRANIVVAEDFPQPVSAGRPYIEDHWESLRIGPDNLHFN
VLGSCQRCQMVCVDQLTGVRGEEPYSTLAKTRKSGNKIYFGRHLAISSNGDGNSVNSRTVMVGDVVTPSYYGP*
Coding >Ani_SJS100_1|g9173.t1
ATGTCAGACAGGGGCAAATGCCAATACCCGGATGATGTGGACGTCATCCGGGAACGTGAATATCCCTTGCTCAAA
GACACGACATATCTTGACCATGCAGGTACTACGCTCTACGCCAAATCCCTGATTGAATCGTTCTCCCGAGACCTC
ACGTCGAACCTCTACGGGAACCCCCATTCCATGTCCGCACCCTCACAGCTATCGACCCAGCGCGTGGATGATATT
CGTCTACGGGCCCTTCGTTTCTTCAGTGCTGATCCGGAAGAATTCGATCTTGTCTTCGTGGCGAATGCTACGGCC
GCAATCAAGCTGGTTGCCGATTCTTTCCGCGAGTCAACACCGCAGGGATTCTGGTATGGATACCATGTGGATTCA
CATACGAGCTTGGTCGGGGCGCGTGAGCTTGCAGGTATCGGGAGCAGGTGCTTCGTGACGGACGCAGAAGTCGAG
AGCTGGATCTCTCAATTAGATACAGAACCGGTGCAAGGTCCCCGACTTTTTGCGTACCCTGCGCAATCGAATATG
AACGGCCGGCGGTTTCCTCGTGGATGGTGCGGCAGGATACGGGAGTCAGCCAAGGACACTTACACGCTTCTTGAT
GTCGCATCGCTTGTGTCGACATCCCCTTTCGACCTCAGTGATGCTTCCGCTGCGCCTGACTTTGCCGTTCTCAGC
TTCTACAAAATCTTCGGGTTCCCGGACCTTGGTGCGTTGATTGTTCGCAAGAGTGCTGGCCACATCTTCGACAAG
CGGAAGTTTTTCGGTGGGGGAACGGTAGATATGGTTCTAACACAGGGAACCCAATGGCATGCGAAGAAGCAATCT
TCAATTCATGAACGACTCGAAGACGGAACGCTTCCGTTTCATAATATAATCGCATTGGGCTCTGCATTTGATACA
CATGAGCGCCTTTTTGGATCTATGGATAATATTTCTTCACACACCCGCTTCCTAGCGAAGCGACTATACGATCGC
ATGACTACATTGAGACATTACAATGGGGAGAGTGTGTGCCATGTATACAAACCATCACACTCTGACTATACCGAT
CCTTCCACGCAAGGACCAATTTTGGCGTTCAACCTGCGAAGCAGTCAAGGTGCCTGGATTGGCAAATCCGAAGTG
GAGAAAATGGCCAGCGTTAGGAACATACAAATCAGATCTGGAACGCTCTGTAACCCGGGAGGCACGGCGGCCAGC
CTTAACTGGTCTGGAGCAGACATGCTTCGGCATTTTGGAGCAGGCATGCGTTGTGGTGATGACCATGATATCATG
GACGGGCGACCTACTGGGATACTGAGAGTAAGCCTTGGCGCGATGAGCAACTTGACTGATATAGACACTTTTATG
GGTTTTATCGAGGAGTTCTACGTCGAGAAAAGCCCAAATGTGTGTGCGTTGGTGCCACCACTGGAAGCCAACCTT
ACTCACCGGTCTGGTTTCCATGTTGAGAGCCTGTCCGTGTATCCCATAAAGAGTTGTGGTGCATTTAAAGTACCT
GACGGAAAGCGCTGGGAAATTCGACGAGAAGGTCTGGTATGGGATCGCGAATGGTGCTTGATCCACCAAGGCACA
GGTACAGCTCTCAATCAAAAGAGGTATCCTCGTATGGCTCTGATACGGCCATTTATCGATCTCAGTCATGGTGTC
TTGCGCGTTACCTGCGGGTCTATACGTTCTCCAAGTCAGAAAACGCTTGAGATCCCTCTGGACCGCGAGAATAGC
AACCTTACAACTACCTCATTATGCCAGAATAGCTCGAAACCTTCTACTGTTTGCGGAGACCAGGTTATTGTGCAG
GCATATTCATCTCCCACGGTGTCCGCATTCTTCTCCGACTTTCTTGGTGTGCCATGTACACTTGCGAGATTTCCG
CCTCAATCCTCCACCAGACTTGCCGAACCCAGACGTGGCCTCGGCAGCAGAAAATCACCACTTCGACCAGCTATG
CCAGGCGCATTCCCTCAAGATACCCCGACCCCTGAGGCAGAACGAAATCCCATCTTACTATCCAACGAGAGTCCA
ATTTTGCTCATCTCCCGCTCATCCGTGAACCGTCTTAACGAAACCATCAAAAGCAGTCCTACAACCACAAATAGT
ACTGGACGCAAGAAAGCCGTAGCTGCCGATGTATTCCGTGCGAACATCGTCGTTGCAGAGGATTTCCCACAGCCG
GTGAGCGCAGGGCGACCGTATATAGAAGACCATTGGGAGAGTCTGCGCATCGGGCCCGACAATCTTCATTTCAAC
GTGCTTGGATCTTGTCAGCGGTGCCAGATGGTCTGCGTCGATCAGCTTACTGGTGTGCGTGGCGAGGAACCATAT
TCGACGTTAGCAAAAACGAGGAAGAGTGGAAACAAGATTTACTTTGGGCGACATTTGGCGATTTCTTCTAATGGC
GATGGAAATAGCGTTAATTCAAGGACAGTAATGGTGGGGGATGTTGTCACTCCGTCTTACTATGGGCCATGA
Transcript >Ani_SJS100_1|g9173.t1
ATGTCAGACAGGGGCAAATGCCAATACCCGGATGATGTGGACGTCATCCGGGAACGTGAATATCCCTTGCTCAAA
GACACGACATATCTTGACCATGCAGGTACTACGCTCTACGCCAAATCCCTGATTGAATCGTTCTCCCGAGACCTC
ACGTCGAACCTCTACGGGAACCCCCATTCCATGTCCGCACCCTCACAGCTATCGACCCAGCGCGTGGATGATATT
CGTCTACGGGCCCTTCGTTTCTTCAGTGCTGATCCGGAAGAATTCGATCTTGTCTTCGTGGCGAATGCTACGGCC
GCAATCAAGCTGGTTGCCGATTCTTTCCGCGAGTCAACACCGCAGGGATTCTGGTATGGATACCATGTGGATTCA
CATACGAGCTTGGTCGGGGCGCGTGAGCTTGCAGGTATCGGGAGCAGGTGCTTCGTGACGGACGCAGAAGTCGAG
AGCTGGATCTCTCAATTAGATACAGAACCGGTGCAAGGTCCCCGACTTTTTGCGTACCCTGCGCAATCGAATATG
AACGGCCGGCGGTTTCCTCGTGGATGGTGCGGCAGGATACGGGAGTCAGCCAAGGACACTTACACGCTTCTTGAT
GTCGCATCGCTTGTGTCGACATCCCCTTTCGACCTCAGTGATGCTTCCGCTGCGCCTGACTTTGCCGTTCTCAGC
TTCTACAAAATCTTCGGGTTCCCGGACCTTGGTGCGTTGATTGTTCGCAAGAGTGCTGGCCACATCTTCGACAAG
CGGAAGTTTTTCGGTGGGGGAACGGTAGATATGGTTCTAACACAGGGAACCCAATGGCATGCGAAGAAGCAATCT
TCAATTCATGAACGACTCGAAGACGGAACGCTTCCGTTTCATAATATAATCGCATTGGGCTCTGCATTTGATACA
CATGAGCGCCTTTTTGGATCTATGGATAATATTTCTTCACACACCCGCTTCCTAGCGAAGCGACTATACGATCGC
ATGACTACATTGAGACATTACAATGGGGAGAGTGTGTGCCATGTATACAAACCATCACACTCTGACTATACCGAT
CCTTCCACGCAAGGACCAATTTTGGCGTTCAACCTGCGAAGCAGTCAAGGTGCCTGGATTGGCAAATCCGAAGTG
GAGAAAATGGCCAGCGTTAGGAACATACAAATCAGATCTGGAACGCTCTGTAACCCGGGAGGCACGGCGGCCAGC
CTTAACTGGTCTGGAGCAGACATGCTTCGGCATTTTGGAGCAGGCATGCGTTGTGGTGATGACCATGATATCATG
GACGGGCGACCTACTGGGATACTGAGAGTAAGCCTTGGCGCGATGAGCAACTTGACTGATATAGACACTTTTATG
GGTTTTATCGAGGAGTTCTACGTCGAGAAAAGCCCAAATGTGTGTGCGTTGGTGCCACCACTGGAAGCCAACCTT
ACTCACCGGTCTGGTTTCCATGTTGAGAGCCTGTCCGTGTATCCCATAAAGAGTTGTGGTGCATTTAAAGTACCT
GACGGAAAGCGCTGGGAAATTCGACGAGAAGGTCTGGTATGGGATCGCGAATGGTGCTTGATCCACCAAGGCACA
GGTACAGCTCTCAATCAAAAGAGGTATCCTCGTATGGCTCTGATACGGCCATTTATCGATCTCAGTCATGGTGTC
TTGCGCGTTACCTGCGGGTCTATACGTTCTCCAAGTCAGAAAACGCTTGAGATCCCTCTGGACCGCGAGAATAGC
AACCTTACAACTACCTCATTATGCCAGAATAGCTCGAAACCTTCTACTGTTTGCGGAGACCAGGTTATTGTGCAG
GCATATTCATCTCCCACGGTGTCCGCATTCTTCTCCGACTTTCTTGGTGTGCCATGTACACTTGCGAGATTTCCG
CCTCAATCCTCCACCAGACTTGCCGAACCCAGACGTGGCCTCGGCAGCAGAAAATCACCACTTCGACCAGCTATG
CCAGGCGCATTCCCTCAAGATACCCCGACCCCTGAGGCAGAACGAAATCCCATCTTACTATCCAACGAGAGTCCA
ATTTTGCTCATCTCCCGCTCATCCGTGAACCGTCTTAACGAAACCATCAAAAGCAGTCCTACAACCACAAATAGT
ACTGGACGCAAGAAAGCCGTAGCTGCCGATGTATTCCGTGCGAACATCGTCGTTGCAGAGGATTTCCCACAGCCG
GTGAGCGCAGGGCGACCGTATATAGAAGACCATTGGGAGAGTCTGCGCATCGGGCCCGACAATCTTCATTTCAAC
GTGCTTGGATCTTGTCAGCGGTGCCAGATGGTCTGCGTCGATCAGCTTACTGGTGTGCGTGGCGAGGAACCATAT
TCGACGTTAGCAAAAACGAGGAAGAGTGGAAACAAGATTTACTTTGGGCGACATTTGGCGATTTCTTCTAATGGC
GATGGAAATAGCGTTAATTCAAGGACAGTAATGGTGGGGGATGTTGTCACTCCGTCTTACTATGGGCCATGA
Gene >Ani_SJS100_1|g9173.t1
ATGTCAGACAGGGGCAAATGCCAATACCCGGATGATGTGGACGTCATCCGGGAACGTGAATATCCCTTGCTCAAA
GGTAGGCCGCGTGCTTGGATGGCTTCTATGCAATTCAAACAATAGATGAACGTACGCTCAGTTATCTAACTACGA
AACCAGACACGACATATCTTGACCATGCAGGTACTACGCTCTACGCCAAATCCCTGATTGAATCGTTCTCCCGAG
ACCTCACGTCGAACCTCTACGGGAACCCCCATTCCATGTCCGCACCCTCACAGCTATCGACCCAGCGCGTGGATG
ATATTCGTCTACGGGCCCTTCGTTTCTTCAGTGCTGATCCGGAAGAATTCGATCTTGTCTTCGTGGCGAATGCTA
CGGCCGCAATCAAGCTGGTTGCCGATTCTTTCCGCGAGTCAACACCGCAGGGATTCTGGTATGGATACCATGTGG
ATTCACATACGAGCTTGGTCGGGGCGCGTGAGCTTGCAGGTATCGGGAGCAGGTGCTTCGTGACGGACGCAGAAG
TCGAGAGCTGGATCTCTCAATTAGATACAGAACCGGTGCAAGGTCCCCGACTTTTTGCGTACCCTGCGCAATCGA
ATATGAACGGCCGGCGGTTTCCTCGTGGATGGTGCGGCAGGATACGGGAGTCAGCCAAGGACACTTACACGCTTC
TTGATGTCGCATCGCTTGTGTCGACATCCCCTTTCGACCTCAGTGATGCTTCCGCTGCGCCTGACTTTGCCGTTC
TCAGCTTCTACAAAATCTTCGGGTTCCCGGACCTTGGTGCGTTGATTGTTCGCAAGAGTGCTGGCCACATCTTCG
ACAAGCGGAAGTTTTTCGGTGGGGGAACGGTAGATATGGTTCTAACACAGGGAACCCAATGGCATGCGAAGAAGC
AATCTTCAATTCATGAACGACTCGAAGACGGAACGCTTCCGTTTCATAATATAATCGCATTGGGCTCTGCATTTG
ATACACATGAGCGCCTTTTTGGATCTATGGATAATATTTCTTCACACACCCGCTTCCTAGCGAAGCGACTATACG
ATCGCATGACTACATTGAGACATTACAATGGGGAGAGTGTGTGCCATGTATACAAACCATCACACTCTGACTATA
CCGATCCTTCCACGCAAGGACCAATTTTGGCGTTCAACCTGCGAAGCAGTCAAGGTGCCTGGATTGGCAAATCCG
AAGTGGAGAAAATGGCCAGCGTTAGGAACATACAAATCAGATCTGGAACGCTCTGTAACCCGGGAGGCACGGCGG
CCAGCCTTAACTGGTCTGGAGCAGACATGCTTCGGCATTTTGGAGCAGGCATGCGTTGTGGTGATGACCATGATA
TCATGGACGGGCGACCTACTGGGATACTGAGAGTAAGCCTTGGCGCGATGAGCAACTTGACTGATATAGACACTT
TTATGGGTTTTATCGAGGAGTTCTACGTCGAGAAAAGCCCAAATGTGTGTGCGTTGGTGCCACCACTGGAAGCCA
ACCTTACTCACCGGTCTGGTTTCCATGTTGAGAGCCTGTCCGTGTATCCCATAAAGAGTTGTGGTGCATTTAAAG
TACCTGACGGAAAGCGCTGGGAAATTCGACGAGAAGGTCTGGTATGGGATCGCGAATGGTGCTTGATCCACCAAG
GCACAGGTACAGCTCTCAATCAAAAGAGGTATCCTCGTATGGCTCTGATACGGCCATTTATCGATCTCAGTCATG
GTGTCTTGCGCGTTACCTGCGGGTCTATACGTTCTCCAAGTCAGAAAACGCTTGAGATCCCTCTGGACCGCGAGA
ATAGCAACCTTACAACTACCTCATTATGCCAGAATAGCTCGAAACCTTCTACTGTTTGCGGAGACCAGGTTATTG
TGCAGGCATATTCATCTCCCACGGTGTCCGCATTCTTCTCCGACTTTCTTGGTGTGCCATGTACACTTGCGAGAT
TTCCGCCTCAATCCTCCACCAGACTTGCCGAACCCAGACGTGGCCTCGGCAGCAGAAAATCACCACTTCGACCAG
CTATGCCAGGCGCATTCCCTCAAGATACCCCGACCCCTGAGGCAGAACGAAATCCCATCTTACTATCCAACGAGA
GTCCAATTTTGCTCATCTCCCGCTCATCCGTGAACCGTCTTAACGAAACCATCAAAAGCAGTCCTACAACCACAA
ATAGTACTGGACGCAAGAAAGCCGTAGCTGCCGATGTATTCCGTGCGAACATCGTCGTTGCAGAGGATTTCCCAC
AGCCGGTGAGCGCAGGGCGACCGTATATAGAAGACCATTGGGAGAGTCTGCGCATCGGGCCCGACAATCTTCATT
TCAACGTGCTTGGATCTTGTCAGCGGTGCCAGATGGTCTGCGTCGATCAGCTTACTGGTGTGCGTGGCGAGGAAC
CATATTCGACGTTAGCAAAAACGAGGAAGAGTGGAAACAAGATTTACTTTGGGCGACATTTGGCGATTTCTTCTA
ATGGCGATGGAAATAGCGTTAATTCAAGGACAGTAATGGTGGGGGATGTTGTCACTCCGTCTTACTATGGGCCAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail