Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g9042.t1
Gene name
Locationscaffold_077:48585..49554
Strand-
Gene length (bp)969
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 8.4E-27 141 277

GO

GO Term Description Terminal node
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g9042.t1
MNSTFAPPAAASYPELYALASQNPKLTFLEKAWWTHYAYWDNDIIATGIITFLAHEILYFARCIPWIIADALPTL
FHRFKIQDKKAPPSAKEQWSCVKYILAIHFIVEMPMIVLFHPMMELFGLKYALPFPDLKTLAIQITIFFFVEDTY
HYWLHRAFHWGPLYRAIHRVHHQYAAPFGLTAEYASPWETMLLGLGTIGPPLVLGYFTGEVHLMTVLAWVALRQF
QAIDAHSGYDFPWSLRRIFPLWGGSDWHDDHHRYFRGNYSSSFKHWDILMGTVAGPRGKKMRQE*
Coding >Ani_SJS100_1|g9042.t1
ATGAACTCGACCTTTGCGCCACCGGCGGCGGCATCATATCCCGAGCTCTATGCCCTGGCGAGCCAAAACCCGAAA
CTGACTTTCCTGGAGAAGGCGTGGTGGACACACTATGCTTACTGGGACAATGACATTATTGCAACTGGCATCATC
ACCTTCCTAGCCCACGAAATCCTCTATTTCGCCCGCTGCATCCCGTGGATAATCGCCGACGCTCTTCCTACATTA
TTTCACCGTTTCAAGATTCAGGACAAAAAGGCACCCCCATCGGCAAAGGAACAATGGAGCTGTGTGAAATATATT
CTTGCTATCCACTTCATTGTGGAAATGCCCATGATCGTTCTGTTCCACCCGATGATGGAACTCTTCGGTCTCAAA
TACGCCCTTCCTTTCCCCGACCTCAAGACCCTCGCCATTCAAATCACAATCTTCTTCTTCGTTGAAGATACATAC
CACTACTGGCTCCATCGTGCCTTTCACTGGGGCCCTCTGTATCGTGCCATTCACCGGGTGCACCACCAGTATGCC
GCGCCGTTTGGGTTGACGGCCGAGTACGCCAGCCCGTGGGAGACCATGCTTCTTGGCCTGGGCACGATTGGACCC
CCTTTGGTTCTGGGCTACTTTACCGGCGAAGTGCATTTGATGACTGTGCTGGCCTGGGTGGCTTTGCGTCAGTTC
CAGGCCATCGACGCGCATTCTGGATACGATTTCCCTTGGAGCCTGAGACGGATCTTCCCGCTGTGGGGAGGATCG
GACTGGCATGACGATCACCATCGGTACTTCCGGGGGAACTACTCTAGCTCGTTTAAGCACTGGGATATCTTAATG
GGAACGGTTGCCGGTCCCCGGGGAAAGAAGATGCGGCAAGAGTGA
Transcript >Ani_SJS100_1|g9042.t1
ATGAACTCGACCTTTGCGCCACCGGCGGCGGCATCATATCCCGAGCTCTATGCCCTGGCGAGCCAAAACCCGAAA
CTGACTTTCCTGGAGAAGGCGTGGTGGACACACTATGCTTACTGGGACAATGACATTATTGCAACTGGCATCATC
ACCTTCCTAGCCCACGAAATCCTCTATTTCGCCCGCTGCATCCCGTGGATAATCGCCGACGCTCTTCCTACATTA
TTTCACCGTTTCAAGATTCAGGACAAAAAGGCACCCCCATCGGCAAAGGAACAATGGAGCTGTGTGAAATATATT
CTTGCTATCCACTTCATTGTGGAAATGCCCATGATCGTTCTGTTCCACCCGATGATGGAACTCTTCGGTCTCAAA
TACGCCCTTCCTTTCCCCGACCTCAAGACCCTCGCCATTCAAATCACAATCTTCTTCTTCGTTGAAGATACATAC
CACTACTGGCTCCATCGTGCCTTTCACTGGGGCCCTCTGTATCGTGCCATTCACCGGGTGCACCACCAGTATGCC
GCGCCGTTTGGGTTGACGGCCGAGTACGCCAGCCCGTGGGAGACCATGCTTCTTGGCCTGGGCACGATTGGACCC
CCTTTGGTTCTGGGCTACTTTACCGGCGAAGTGCATTTGATGACTGTGCTGGCCTGGGTGGCTTTGCGTCAGTTC
CAGGCCATCGACGCGCATTCTGGATACGATTTCCCTTGGAGCCTGAGACGGATCTTCCCGCTGTGGGGAGGATCG
GACTGGCATGACGATCACCATCGGTACTTCCGGGGGAACTACTCTAGCTCGTTTAAGCACTGGGATATCTTAATG
GGAACGGTTGCCGGTCCCCGGGGAAAGAAGATGCGGCAAGAGTGA
Gene >Ani_SJS100_1|g9042.t1
ATGAACTCGACCTTTGCGCCACCGGCGGCGGCATCATATCCCGAGCTCTATGCCCTGGCGAGCCAAAACCCGAAA
CTGACTTTCCTGGAGAAGGCGTGGTGGACACACTATGCTTACTGGGACAATGACATTATTGCAACTGGTACACCG
CCCCGATACATTGTCTCTGTCACCTACTAACTCCGACAGGCATCATCACCTTCCTAGCCCACGAAATCCTCTATT
TCGCCCGCTGCATCCCGTGGATAATCGCCGACGCTCTTCCTACATTATTTCACCGTTTCAAGATTCAGGACAAAA
AGGCACCCCCATCGGCAAAGGAACAATGGAGCTGTGTGAAATATATTCTTGCTATCCACTTCATTGTGGAAATGC
CCATGATCGTTCTGTTCCACCCGATGATGGAACTCTTCGGTCTCAAATACGCCCTTCCTTTCCCCGACCTCAAGA
CCCTCGCCATTCAAATCACAATCTTCTTCTTCGTTGAAGATACATACCACTACTGGCTCCATCGTGCCTTTCACT
GGGGCCCTCTGTATCGTGCCATTCACCGGGTGCACCACCAGTATGCCGCGCCGTTTGGGTTGACGGCCGAGTACG
CCAGCCCGTGGGAGACCATGCTTCTTGGCCTGGGCACGATTGGACCCCCTTTGGTTCTGGGCTACTTTACCGGCG
AAGTGCATTTGATGACTGTGCTGGCCTGGGTGGCTTTGCGTCAGTTCCAGGCCATCGACGCGCATTCTGGATACG
ATTTCCCTTGGAGCCTGAGACGGATCTTCCCGCTGTGGGGAGGATCGGACTGGCATGACGATCACCATCGGTACT
TCCGGGGGAACTACTCTAGCTCGTTTAAGCACTGGGATAGTGAGTCTCTCTTCTCTCGTCTTTGTCAGTGTTCTT
GACTAACGGGTTGCAGTCTTAATGGGAACGGTTGCCGGTCCCCGGGGAAAGAAGATGCGGCAAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail