Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g8861.t1
Gene name
Locationscaffold_073:151981..153685
Strand-
Gene length (bp)1704
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03473 MOSC MOSC domain 1.7E-26 64 189
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 6.0E-10 489 555
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 1.2E-06 364 451

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0030151 molybdenum ion binding Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0019842 vitamin binding No
GO:0051540 metal cluster binding No
GO:0043169 cation binding No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0070279 vitamin B6 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g8861.t1
MTRIDFTSPSQPPLIPIPPPTTLQEIRTSKLRPFGPVLSAIDKQTRPGQLYVSTTGLEDDEHDLAFHGGIDKAIH
QYCADHYSYWADRFPEARARFIPGGFGENLVADGWNEQTVCIGDRVRIGPPGSLRTGGRNGCVLEVSLPRQPCFK
LNQRFGIKNFAPLTHQEAKTGWYYRVVEEGWIQEGMEIRVIHRSHARWSIARLHHYVHRDKTDLAATQHLIAMEV
LGDECKDVFIDRWRAHEEKEAAAKRPPETWRQFRVVSHTAETPRIVRLELEAVRRSAPSPSAILPGSHARLKLPS
GLRRAYSIVHGDTDRFTLGVALDERSRGGSSYIHQTLKQGDTILVASEIRQGLTIDNMASHHIFIAGGIGITALI
AMMKRLKDTNQDYSLHYAVRSTTDIAFQPLLIALQSHVTIYDKSQGQRLDIAKILRNRIWNSHVYVCGPQRMIDD
VIQTAAGVDMSSDEVHYELFNGEDAGGDPFTVDVVGPNRKSEGLQVGAEQSLLEILRDAGFEIGSSCEVGNCGTC
RVSVRCGRVLHRGTALMESEQRSEMLACVSRGVGHIVVELGE*
Coding >Ani_SJS100_1|g8861.t1
ATGACCCGCATCGACTTCACTTCACCATCACAACCACCCCTCATCCCCATTCCGCCCCCCACGACCCTCCAAGAG
ATCCGCACCTCCAAGCTCCGCCCCTTCGGCCCCGTCCTCTCCGCCATCGACAAACAAACCCGTCCCGGCCAACTA
TACGTCTCCACTACCGGCCTCGAAGACGACGAGCACGATCTGGCCTTCCACGGCGGTATCGACAAAGCCATTCAC
CAGTACTGCGCGGACCATTACTCCTACTGGGCCGATCGCTTTCCCGAGGCCCGCGCGCGCTTCATACCAGGCGGG
TTTGGCGAGAACCTCGTCGCCGATGGCTGGAACGAGCAGACCGTCTGCATCGGCGACAGGGTGCGCATCGGGCCC
CCGGGTTCCCTGCGCACCGGCGGCCGCAATGGTTGCGTCCTAGAGGTCAGTCTGCCGCGCCAGCCGTGCTTCAAG
CTGAATCAGCGCTTCGGGATCAAGAACTTCGCTCCACTCACTCACCAAGAGGCCAAGACGGGATGGTATTATCGT
GTCGTTGAGGAGGGTTGGATTCAGGAAGGCATGGAGATTCGCGTCATTCATCGGAGTCATGCGCGATGGTCCATC
GCTCGGCTGCATCACTATGTCCACCGCGATAAGACGGACTTGGCGGCGACGCAGCATCTTATTGCCATGGAGGTC
CTGGGGGATGAGTGCAAGGACGTGTTTATTGACCGCTGGAGAGCCCATGAGGAGAAGGAGGCCGCGGCTAAGCGT
CCACCTGAGACATGGAGGCAGTTCAGAGTCGTCAGTCATACCGCGGAGACACCTCGTATCGTGCGGCTGGAGCTG
GAGGCAGTGCGCCGAAGTGCACCTTCACCTAGTGCTATACTACCCGGCAGCCATGCCCGGCTCAAGCTCCCATCT
GGTCTACGCCGGGCCTACTCCATCGTCCATGGCGACACGGATCGCTTCACGCTGGGCGTGGCCCTAGACGAACGC
AGCCGCGGCGGATCGAGCTATATCCACCAAACACTCAAACAAGGTGACACAATCCTAGTGGCCTCCGAGATACGG
CAGGGCCTCACCATCGACAACATGGCATCTCACCACATCTTCATCGCGGGCGGCATAGGAATCACAGCGCTTATC
GCCATGATGAAACGCCTCAAAGACACCAACCAGGACTATTCCCTACATTATGCTGTGCGGAGCACCACCGACATC
GCCTTCCAGCCTCTTCTAATCGCCCTACAGTCCCACGTCACCATCTACGACAAATCCCAGGGCCAACGCCTCGAC
ATTGCGAAGATTCTGCGAAATCGCATCTGGAACAGCCACGTCTATGTGTGTGGGCCACAGCGCATGATCGATGAC
GTGATTCAGACAGCCGCTGGTGTAGACATGTCTTCTGATGAGGTGCATTACGAGTTATTTAATGGTGAGGATGCC
GGGGGCGACCCCTTCACTGTGGATGTTGTTGGTCCGAACAGAAAGTCCGAGGGGCTCCAGGTCGGCGCTGAGCAG
TCGCTTCTTGAGATTTTGCGGGATGCTGGCTTCGAGATTGGAAGTTCTTGTGAGGTGGGGAACTGTGGCACTTGT
AGGGTTTCTGTTCGCTGTGGGAGGGTGCTGCATCGGGGTACGGCTTTGATGGAGTCGGAGCAGAGGTCGGAGATG
TTGGCTTGTGTTTCAAGGGGGGTGGGGCATATTGTTGTTGAGCTTGGTGAGTAG
Transcript >Ani_SJS100_1|g8861.t1
ATGACCCGCATCGACTTCACTTCACCATCACAACCACCCCTCATCCCCATTCCGCCCCCCACGACCCTCCAAGAG
ATCCGCACCTCCAAGCTCCGCCCCTTCGGCCCCGTCCTCTCCGCCATCGACAAACAAACCCGTCCCGGCCAACTA
TACGTCTCCACTACCGGCCTCGAAGACGACGAGCACGATCTGGCCTTCCACGGCGGTATCGACAAAGCCATTCAC
CAGTACTGCGCGGACCATTACTCCTACTGGGCCGATCGCTTTCCCGAGGCCCGCGCGCGCTTCATACCAGGCGGG
TTTGGCGAGAACCTCGTCGCCGATGGCTGGAACGAGCAGACCGTCTGCATCGGCGACAGGGTGCGCATCGGGCCC
CCGGGTTCCCTGCGCACCGGCGGCCGCAATGGTTGCGTCCTAGAGGTCAGTCTGCCGCGCCAGCCGTGCTTCAAG
CTGAATCAGCGCTTCGGGATCAAGAACTTCGCTCCACTCACTCACCAAGAGGCCAAGACGGGATGGTATTATCGT
GTCGTTGAGGAGGGTTGGATTCAGGAAGGCATGGAGATTCGCGTCATTCATCGGAGTCATGCGCGATGGTCCATC
GCTCGGCTGCATCACTATGTCCACCGCGATAAGACGGACTTGGCGGCGACGCAGCATCTTATTGCCATGGAGGTC
CTGGGGGATGAGTGCAAGGACGTGTTTATTGACCGCTGGAGAGCCCATGAGGAGAAGGAGGCCGCGGCTAAGCGT
CCACCTGAGACATGGAGGCAGTTCAGAGTCGTCAGTCATACCGCGGAGACACCTCGTATCGTGCGGCTGGAGCTG
GAGGCAGTGCGCCGAAGTGCACCTTCACCTAGTGCTATACTACCCGGCAGCCATGCCCGGCTCAAGCTCCCATCT
GGTCTACGCCGGGCCTACTCCATCGTCCATGGCGACACGGATCGCTTCACGCTGGGCGTGGCCCTAGACGAACGC
AGCCGCGGCGGATCGAGCTATATCCACCAAACACTCAAACAAGGTGACACAATCCTAGTGGCCTCCGAGATACGG
CAGGGCCTCACCATCGACAACATGGCATCTCACCACATCTTCATCGCGGGCGGCATAGGAATCACAGCGCTTATC
GCCATGATGAAACGCCTCAAAGACACCAACCAGGACTATTCCCTACATTATGCTGTGCGGAGCACCACCGACATC
GCCTTCCAGCCTCTTCTAATCGCCCTACAGTCCCACGTCACCATCTACGACAAATCCCAGGGCCAACGCCTCGAC
ATTGCGAAGATTCTGCGAAATCGCATCTGGAACAGCCACGTCTATGTGTGTGGGCCACAGCGCATGATCGATGAC
GTGATTCAGACAGCCGCTGGTGTAGACATGTCTTCTGATGAGGTGCATTACGAGTTATTTAATGGTGAGGATGCC
GGGGGCGACCCCTTCACTGTGGATGTTGTTGGTCCGAACAGAAAGTCCGAGGGGCTCCAGGTCGGCGCTGAGCAG
TCGCTTCTTGAGATTTTGCGGGATGCTGGCTTCGAGATTGGAAGTTCTTGTGAGGTGGGGAACTGTGGCACTTGT
AGGGTTTCTGTTCGCTGTGGGAGGGTGCTGCATCGGGGTACGGCTTTGATGGAGTCGGAGCAGAGGTCGGAGATG
TTGGCTTGTGTTTCAAGGGGGGTGGGGCATATTGTTGTTGAGCTTGGTGAGTAG
Gene >Ani_SJS100_1|g8861.t1
ATGACCCGCATCGACTTCACTTCACCATCACAACCACCCCTCATCCCCATTCCGCCCCCCACGACCCTCCAAGAG
ATCCGCACCTCCAAGCTCCGCCCCTTCGGCCCCGTCCTCTCCGCCATCGACAAACAAACCCGTCCCGGCCAACTA
TACGTCTCCACTACCGGCCTCGAAGACGACGAGCACGATCTGGCCTTCCACGGCGGTATCGACAAAGCCATTCAC
CAGTACTGCGCGGACCATTACTCCTACTGGGCCGATCGCTTTCCCGAGGCCCGCGCGCGCTTCATACCAGGCGGG
TTTGGCGAGAACCTCGTCGCCGATGGCTGGAACGAGCAGACCGTCTGCATCGGCGACAGGGTGCGCATCGGGCCC
CCGGGTTCCCTGCGCACCGGCGGCCGCAATGGTTGCGTCCTAGAGGTCAGTCTGCCGCGCCAGCCGTGCTTCAAG
CTGAATCAGCGCTTCGGGATCAAGAACTTCGCTCCACTCACTCACCAAGAGGCCAAGACGGGATGGTATTATCGT
GTCGTTGAGGAGGGTTGGATTCAGGAAGGCATGGAGATTCGCGTCATTCATCGGAGTCATGCGCGATGGTCCATC
GCTCGGCTGCATCACTATGTCCACCGCGATAAGACGGACTTGGCGGCGACGCAGCATCTTATTGCCATGGAGGTC
CTGGGGGATGAGTGCAAGGACGTGTTTATTGACCGCTGGAGAGCCCATGAGGAGAAGGAGGCCGCGGCTAAGCGT
CCACCTGAGACATGGAGGCAGTTCAGAGTCGTCAGTCATACCGCGGAGACACCTCGTATCGTGCGGCTGGAGCTG
GAGGCAGTGCGCCGAAGTGCACCTTCACCTAGTGCTATACTACCCGGCAGCCATGCCCGGCTCAAGCTCCCATCT
GGTCTACGCCGGGCCTACTCCATCGTCCATGGCGACACGGATCGCTTCACGCTGGGCGTGGCCCTAGACGAACGC
AGCCGCGGCGGATCGAGCTATATCCACCAAACACTCAAACAAGGTGACACAATCCTAGTGGCCTCCGAGATACGG
CAGGGCCTCACCATCGACAACATGGCATCTCACCACATCTTCATCGCGGGCGGCATAGGAATCACAGCGCTTATC
GCCATGATGAAACGCCTCAAAGACACCAACCAGGACTATTCCCTACATTATGCTGTGCGGAGCACCACCGACATC
GCCTTCCAGCCTCTTCTAATCGCCCTACAGTCCCACGTCACCATCTACGACAAATCCCAGGGCCAACGCCTCGAC
ATTGCGAAGATTCTGCGAAATCGCATCTGGAACAGCCACGTCTATGTGTGTGGGCCACAGCGCATGATCGATGAC
GTGATTCAGACAGCCGCTGGTGTAGACATGTCTTCTGATGAGGTGCATTACGAGTTATTTAATGGTGAGGATGCC
GGGGGCGACCCCTTCACTGTGGATGTTGTTGGTCCGAACAGAAAGTCCGAGGGGCTCCAGGTCGGCGCTGAGCAG
TCGCTTCTTGAGATTTTGCGGGATGCTGGCTTCGAGATTGGAAGTTCTTGTGAGGTGGGGAACTGTGGCACTTGT
AGGGTTTCTGTTCGCTGTGGGAGGGTGCTGCATCGGGGTACGGCTTTGATGGAGTCGGAGCAGAGGTCGGAGATG
TTGGCTTGTGTTTCAAGGGGGGTGGGGCATATTGTTGTTGAGCTTGGTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail