Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g8849.t1
Gene name
Locationscaffold_073:122281..123122
Strand+
Gene length (bp)841
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11937 DUF3455 Protein of unknown function (DUF3455) 6.3E-52 74 252
PF11693 DUF2990 Protein of unknown function (DUF2990) 6.8E-30 10 72

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g8849.t1
MRANLFLLGCLTAGSMAAPTLLNDIYDYSSDLATYLGKVSKYIESTGEELIKSANSCDTSKISLPSYASSLPSPS
GMSPIYVAVGRGTQNYTCATSTSDSTPQAIGAVARLYNATCIAANYPDMLSLLPGIVYKEQLPSNEEDPLPPANL
ELLGHHFFRDTTTPVFNLDTLPSRQYGIAITKKQDSLDAPSSAIQGSNGAVQWLYLTTINGTVGEYKAVYRVDTV
AGAAPKTCQGMQSVFTVQYAANYYFYGA*
Coding >Ani_SJS100_1|g8849.t1
ATGCGTGCGAACCTCTTTCTCCTGGGCTGCCTGACAGCAGGCTCCATGGCAGCGCCAACCCTCCTCAACGACATA
TACGACTATTCGTCGGACTTAGCCACCTACCTCGGAAAAGTGAGCAAGTACATCGAGAGCACGGGAGAAGAACTC
ATTAAGAGCGCCAACTCATGCGATACATCCAAAATTTCTCTTCCATCATACGCCTCCAGCCTGCCCTCACCATCC
GGAATGAGCCCAATCTATGTGGCAGTCGGCCGTGGCACCCAGAACTACACCTGCGCCACCTCGACCTCGGACTCA
ACGCCCCAAGCCATAGGTGCAGTGGCGCGTCTTTACAACGCGACCTGCATCGCGGCCAATTACCCGGACATGTTG
TCGTTACTCCCGGGTATAGTGTACAAGGAACAGTTGCCCAGTAACGAGGAGGATCCCCTCCCGCCGGCGAACCTT
GAACTCTTGGGTCACCATTTCTTCAGAGATACGACTACCCCGGTTTTTAACCTGGATACTTTGCCATCTCGGCAG
TATGGGATTGCGATCACAAAGAAACAAGACTCGCTTGATGCTCCATCGAGTGCTATTCAGGGTAGCAACGGGGCT
GTCCAGTGGCTTTACCTGACCACTATCAATGGTACAGTCGGTGAGTATAAAGCGGTCTATCGAGTAGACACGGTT
GCCGGTGCAGCTCCGAAGACCTGCCAGGGGATGCAGTCGGTGTTCACTGTTCAGTATGCGGCCAATTACTATTTC
TATGGTGCATGA
Transcript >Ani_SJS100_1|g8849.t1
ATGCGTGCGAACCTCTTTCTCCTGGGCTGCCTGACAGCAGGCTCCATGGCAGCGCCAACCCTCCTCAACGACATA
TACGACTATTCGTCGGACTTAGCCACCTACCTCGGAAAAGTGAGCAAGTACATCGAGAGCACGGGAGAAGAACTC
ATTAAGAGCGCCAACTCATGCGATACATCCAAAATTTCTCTTCCATCATACGCCTCCAGCCTGCCCTCACCATCC
GGAATGAGCCCAATCTATGTGGCAGTCGGCCGTGGCACCCAGAACTACACCTGCGCCACCTCGACCTCGGACTCA
ACGCCCCAAGCCATAGGTGCAGTGGCGCGTCTTTACAACGCGACCTGCATCGCGGCCAATTACCCGGACATGTTG
TCGTTACTCCCGGGTATAGTGTACAAGGAACAGTTGCCCAGTAACGAGGAGGATCCCCTCCCGCCGGCGAACCTT
GAACTCTTGGGTCACCATTTCTTCAGAGATACGACTACCCCGGTTTTTAACCTGGATACTTTGCCATCTCGGCAG
TATGGGATTGCGATCACAAAGAAACAAGACTCGCTTGATGCTCCATCGAGTGCTATTCAGGGTAGCAACGGGGCT
GTCCAGTGGCTTTACCTGACCACTATCAATGGTACAGTCGGTGAGTATAAAGCGGTCTATCGAGTAGACACGGTT
GCCGGTGCAGCTCCGAAGACCTGCCAGGGGATGCAGTCGGTGTTCACTGTTCAGTATGCGGCCAATTACTATTTC
TATGGTGCATGA
Gene >Ani_SJS100_1|g8849.t1
ATGCGTGCGAACCTCTTTCTCCTGGGCTGCCTGACAGCAGGCTCCATGGCAGCGCCAACCCTCCTCAACGACATA
TACGACTATTCGTCGGACTTAGCCACCTACCTCGGAAAAGTGAGCAAGTACATCGAGAGCACGGGAGAAGAACTC
ATTAAGAGCGCCAACTCATGCGATACATCCAAAATTTCTCTTCCATCATACGCCTCCAGCCTGCCCTCACCATCC
GGAATGAGCCCAATCTATGTGGCAGTCGGCCGTGGCACCCAGGTAAGCAGAAGAAGACCCGCCTACTGTCACACA
GTCAATGCAGGGGGAGACCCGGCCGAACTGACAAGCCCCTCCTTAGAACTACACCTGCGCCACCTCGACCTCGGA
CTCAACGCCCCAAGCCATAGGTGCAGTGGCGCGTCTTTACAACGCGACCTGCATCGCGGCCAATTACCCGGACAT
GTTGTCGTTACTCCCGGGTATAGTGTACAAGGAACAGTTGCCCAGTAACGAGGAGGATCCCCTCCCGCCGGCGAA
CCTTGAACTCTTGGGTCACCATTTCTTCAGAGATACGACTACCCCGGTTTTTAACCTGGATACTTTGCCATCTCG
GCAGTATGGGATTGCGATCACAAAGAAACAAGACTCGCTTGATGCTCCATCGAGTGCTATTCAGGGTAGCAACGG
GGCTGTCCAGTGGCTTTACCTGACCACTATCAATGGTACAGTCGGTGAGTATAAAGCGGTCTATCGAGTAGACAC
GGTTGCCGGTGCAGCTCCGAAGACCTGCCAGGGGATGCAGTCGGTGTTCACTGTTCAGTATGCGGCCAATTACTA
TTTCTATGGTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail