Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g8721.t1
Gene name
Locationscaffold_071:69473..74750
Strand-
Gene length (bp)5277
Transcript length (bp)5277
Coding sequence length (bp)5277
Protein length (aa) 1759

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 6.4E-46 977 1289
PF00271 Helicase_C Helicase conserved C-terminal domain 4.3E-19 1357 1467
PF04851 ResIII Type III restriction enzyme, res subunit 1.8E-05 957 1157
PF07647 SAM_2 SAM domain (Sterile alpha motif) 3.7E-05 45 87

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0005515 protein binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0032555 purine ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0003674 molecular_function No
GO:0140657 ATP-dependent activity No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0140097 catalytic activity, acting on DNA No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g8721.t1
MEPGGDPLDWTVDEVVQFLCRNPQTPWSRSSSRAPRPDPITFEATLRDNEITGEVLMHDVDKETLREDLGVRALG
HRSSILMAIRYIQRKSLKFQESRNLGTLSEDHIDYANPVVPRLDSPVYHLPPSHNVTPQQGLHQSARLQTSSPKA
SPQEPSGDVPKADSERRAGFVEHHKPSEAASRPGILQRNEGNAWSSSEQPPEGRIRPGEDLVVDAHGKKRRKLNL
SAMTQDETGPDVSRQTNRPKSPKEWYLGPEKLNVSRLFYTSDPDSDPAEHDQTFSMIASRLPAGRRRFVNQRLIY
FHKQRPVKLSSTQSALVPYRELTKQKSKPTKKEVVIGHSNPRPCTLYTVHNGRVTVTRDELQRWPQLVQSEEADS
GGAKDHDPFAYLLQKYPAQNDDDDGLDTLPLYGDSGSEGEFDDDIWQEIEDERREPLPRQTTLTSAEIKSIIASC
ISEYENNWLQDGRTREEPKARRIWLSSRRGKTTNEQIKTITRDVSLLERRLGVFTKAIEESEYASRKELQVQCRS
LENTVINIQKQKWLISVLELEQCPPKMAYPTRPLPPIRQSIDEDGESLGSETDHGAVDDDSLDDFIEDDVFRKSP
TPSSDDDDIISPSGKRRRFRTTAHPFVESSSPSPPPLPEGPIETIDLTGDDPLPEEDDFTVETPPLNPARQTPQS
EHVLSREISPAPKLPPKVYVEIPNVVIPETEIPTPSKQDGIAQSVASSARPHLDSLEDLPEINDFNKLKGIGWRL
LEERYDRCRLLAKLIASLADEERQRLTRMVPTYDVKSLQSLTNTALKRLWKSKETISGLTPDEASFAMRTASLFI
SWINCAHYHVKGFPKTHVWEAKERVSDFPEFYKELSCRLDAYQTWDINRQQTAVTAFDSPHKKRKREVKESQAAK
MNQEIAKLRVAHQEKLRQKLERRLESMGVSNTDATRQAVSFGDPVIYLDPHIGQRVKPHQLHGIQFMWRELTEDG
GKHQGCLLAHTMGLGKTMQVISLLVTIANAAASENPWIKKQIPDNLLRSQTLILCPSSLIENWYEEFIMWTPKDS
AIGPVNKVTSSASLAERLNTVALWNEEGGVLLISYDIFRTWIYNKETIRRGKPLSEEEHENIKKWLLEGANIIVA
DEAHKMKNPASAITLAAMQFRSQSRIALTGSPLANNLVDYFTMVNWIAGGYLGEFTEFKANFVEPIEEGLYVDST
HSERRRSLVKLQVLNKILEPKINRADISVLEGSLPPKVEFVITVPLTDVQKSAYDLYVQSILEGSQDFSRMKLLS
WLAVLGLCCNHPACFRDKLLSRASDAQKLDRMIDGAAIEPAPGDEPITQLGLDVEGLVSKQEQLFSTVPDMSAAT
LSSRAEILNRIIAESVRAGDKVLVFSHSIPTLNYVENDILKAFGWKYCRLDGSTPMASRQAATKQFNQGSAEDVY
LISTRAGGLGLNIFGANRVIIFDFTFNPVWEEQAVGRAYRLGQKKPVFVYRFIAGGTFEEVMYNKAVFKTQLAFR
VVDKKNPIRLATKSLGEYLFPAKQTPQQDVTECLGKDPEVLDKIIRADAHTDENQRLIRKIKLTELFQKDDNDKL
TEDEKNAAQQQLDDERLKRTDYEAYQRMIIERQRRALAQGTGPYGTTPAMLSGQLPSQLPPQPFAPQPPAPAPQL
TVPASAHNVGPPALAPDTSITQQAPQTPVAIPGLTLTSPDQAHAQSTPVTPGNNTNSSLLTHNTSATAASAQTYN
GGGSTTEGSSAIRDRSESPEALQDHNKPSCRPQ*
Coding >Ani_SJS100_1|g8721.t1
ATGGAGCCTGGCGGAGACCCTCTAGATTGGACGGTCGATGAAGTGGTGCAATTCCTATGTCGAAACCCGCAGACA
CCATGGTCTCGGTCATCATCGCGTGCTCCACGACCGGACCCTATCACCTTTGAAGCTACGCTTCGGGATAATGAA
ATCACCGGCGAGGTGCTGATGCATGATGTAGACAAAGAGACACTACGGGAGGACCTTGGCGTGAGAGCTCTTGGC
CATCGTAGCTCTATACTCATGGCAATACGCTATATCCAGCGAAAGTCTCTCAAGTTCCAGGAATCCAGAAATCTA
GGCACTTTGTCTGAAGACCACATCGACTACGCGAACCCGGTTGTCCCTCGACTAGACTCCCCAGTGTACCATCTG
CCTCCGTCTCACAATGTGACACCACAACAAGGGCTTCACCAAAGTGCTCGTCTTCAGACTTCTTCACCCAAGGCC
TCGCCGCAGGAGCCTTCCGGGGACGTCCCCAAAGCTGATTCTGAACGTAGAGCTGGTTTTGTGGAGCATCACAAG
CCAAGCGAGGCTGCAAGTCGCCCAGGTATCTTACAGAGAAATGAGGGAAACGCCTGGTCATCTTCAGAACAACCA
CCGGAAGGACGCATTCGGCCTGGTGAAGATTTGGTTGTCGATGCCCATGGCAAGAAACGACGAAAGCTAAATCTT
AGTGCCATGACTCAGGACGAGACTGGCCCTGATGTTTCAAGACAGACAAACAGACCTAAAAGTCCCAAAGAGTGG
TACCTGGGTCCAGAAAAGCTCAATGTTTCCAGACTTTTCTATACATCTGACCCGGACTCCGACCCAGCAGAACAT
GACCAAACCTTCTCAATGATCGCCTCCAGACTTCCAGCTGGCCGGCGCAGATTCGTGAACCAGAGGCTTATCTAT
TTCCACAAGCAGCGGCCCGTGAAGCTAAGCTCCACGCAGTCAGCATTGGTTCCTTATCGAGAATTGACCAAGCAA
AAAAGTAAGCCAACGAAGAAGGAAGTAGTCATAGGCCATAGCAACCCAAGGCCTTGCACCTTGTATACTGTGCAT
AATGGCAGAGTCACAGTCACTAGAGACGAACTACAGAGGTGGCCGCAATTAGTTCAGTCGGAGGAGGCCGATAGC
GGGGGCGCAAAGGACCATGATCCCTTTGCCTACCTGTTACAAAAATACCCCGCACAAAATGATGATGATGATGGC
CTTGATACTCTTCCCCTCTATGGAGACTCAGGATCGGAGGGTGAGTTCGATGATGACATATGGCAGGAAATTGAG
GATGAACGCCGGGAACCATTGCCACGGCAAACAACCCTCACATCTGCTGAGATTAAATCTATCATTGCAAGTTGC
ATTTCAGAATATGAGAACAACTGGCTGCAAGATGGAAGGACAAGAGAGGAGCCAAAGGCACGAAGAATTTGGTTA
TCTTCTAGGAGAGGTAAAACCACTAATGAACAAATCAAGACTATCACCCGCGACGTTAGTCTTCTAGAACGGCGT
CTAGGTGTATTCACGAAAGCAATAGAGGAAAGTGAATATGCATCACGGAAAGAGCTACAAGTACAATGCCGGAGT
CTGGAGAACACCGTCATCAACATCCAGAAGCAAAAGTGGCTTATATCGGTTCTTGAACTCGAGCAGTGTCCGCCG
AAGATGGCTTACCCTACGAGGCCTTTGCCTCCCATAAGGCAAAGCATTGACGAGGATGGAGAGTCGCTTGGCTCG
GAAACCGATCATGGCGCTGTTGATGATGACTCTCTTGACGATTTCATTGAGGATGACGTTTTCCGCAAAAGCCCT
ACCCCTTCGTCGGACGACGATGATATCATTAGTCCTTCTGGAAAAAGGCGAAGATTCAGGACTACAGCACATCCT
TTCGTTGAGTCCAGTTCCCCCTCCCCTCCGCCACTTCCTGAAGGACCAATAGAGACTATTGACCTGACTGGCGAT
GATCCACTGCCTGAAGAGGATGACTTTACCGTTGAGACGCCCCCATTGAACCCAGCGCGACAGACGCCGCAATCT
GAACACGTCTTGTCAAGAGAAATCTCTCCTGCACCAAAGCTTCCTCCTAAAGTGTATGTCGAGATACCGAATGTC
GTGATACCGGAAACCGAGATACCGACACCATCGAAACAAGATGGCATCGCACAGTCAGTTGCAAGTTCCGCAAGG
CCTCATCTAGACAGTTTAGAGGACCTGCCCGAAATCAACGATTTTAACAAGCTCAAGGGAATCGGTTGGAGGCTC
TTGGAGGAGCGTTATGACCGTTGCAGACTCCTGGCAAAGTTGATAGCATCACTCGCAGATGAAGAACGACAGAGA
TTGACTAGGATGGTTCCGACATATGACGTAAAAAGCCTGCAAAGCCTCACAAACACGGCTTTGAAAAGACTGTGG
AAAAGCAAGGAAACAATATCAGGGCTGACACCTGATGAGGCTAGTTTTGCCATGCGCACGGCATCCCTCTTTATT
TCATGGATAAATTGCGCACATTACCACGTGAAGGGCTTCCCAAAAACCCATGTTTGGGAGGCAAAAGAACGTGTC
TCGGATTTCCCCGAGTTTTACAAGGAACTCTCCTGCCGCTTGGATGCGTATCAAACCTGGGATATAAACCGGCAA
CAGACCGCCGTGACTGCTTTTGACTCACCCCACAAGAAAAGGAAACGGGAAGTGAAGGAGAGCCAAGCCGCAAAA
ATGAATCAAGAAATCGCCAAACTTCGTGTTGCTCATCAAGAGAAGTTGAGGCAGAAGCTTGAACGCAGATTGGAA
AGCATGGGTGTCAGCAATACCGATGCCACTCGCCAGGCTGTCAGTTTTGGCGATCCTGTCATCTACTTGGACCCT
CATATCGGACAGCGTGTCAAGCCTCATCAATTGCATGGCATCCAATTTATGTGGCGAGAACTGACTGAGGATGGT
GGAAAACATCAGGGCTGTCTCCTTGCTCATACAATGGGCTTGGGTAAAACGATGCAGGTCATCTCCCTCCTTGTG
ACTATAGCGAATGCGGCTGCTTCTGAGAACCCTTGGATAAAGAAGCAAATCCCAGACAACCTCCTTCGATCCCAG
ACTCTTATTCTTTGCCCGTCGTCACTGATCGAGAACTGGTACGAAGAGTTCATTATGTGGACCCCTAAGGATTCG
GCCATCGGGCCTGTCAACAAAGTGACCAGCTCGGCTTCTCTCGCGGAAAGGCTGAACACTGTGGCTCTTTGGAAT
GAAGAAGGCGGAGTACTTCTTATCAGCTATGACATATTTCGGACATGGATCTATAATAAAGAAACAATCAGGAGA
GGCAAGCCTCTCTCGGAAGAGGAGCATGAGAACATTAAGAAGTGGCTTCTAGAAGGAGCTAACATCATTGTTGCT
GATGAAGCCCATAAGATGAAGAACCCAGCTTCTGCAATTACTCTTGCGGCCATGCAGTTCCGCTCTCAGAGCCGC
ATTGCATTGACTGGCTCTCCTCTTGCGAATAATCTTGTGGATTACTTTACCATGGTCAACTGGATTGCAGGAGGT
TATCTGGGAGAGTTCACAGAGTTCAAGGCTAACTTTGTAGAGCCTATTGAGGAAGGTCTGTACGTGGATAGCACA
CATAGCGAGCGGCGGCGGTCTCTTGTGAAGCTTCAGGTCCTGAACAAGATTCTTGAACCAAAGATCAACCGGGCT
GATATCTCTGTCCTTGAGGGCAGCTTGCCCCCCAAGGTCGAATTCGTCATTACTGTTCCATTAACGGATGTGCAA
AAGTCTGCATACGATCTATACGTGCAGTCGATTCTAGAGGGCAGCCAGGATTTTAGCAGGATGAAGCTACTGTCT
TGGCTAGCCGTGCTAGGTCTGTGTTGCAATCACCCAGCTTGTTTCAGAGATAAGCTTCTCAGCAGAGCCAGCGAT
GCTCAGAAGCTCGATAGAATGATAGACGGCGCCGCGATCGAACCAGCCCCTGGTGACGAGCCTATCACGCAGCTG
GGACTGGACGTTGAGGGTCTCGTTTCAAAACAAGAGCAGCTTTTCTCTACTGTTCCTGACATGAGCGCCGCAACA
CTGTCAAGTCGAGCCGAAATTTTGAACAGGATCATCGCAGAGTCTGTCCGGGCTGGAGATAAAGTGCTTGTGTTT
TCACACAGCATACCTACGCTCAACTACGTCGAGAATGATATTCTCAAGGCATTTGGTTGGAAATATTGCCGTCTA
GATGGAAGCACTCCAATGGCCAGCCGACAAGCTGCTACCAAGCAGTTCAATCAAGGCTCTGCAGAGGATGTATAC
CTAATTTCCACCCGTGCCGGCGGCCTAGGCCTAAACATCTTCGGTGCTAACCGTGTCATCATTTTCGACTTCACA
TTCAATCCCGTCTGGGAGGAACAGGCCGTCGGACGTGCCTATCGCTTAGGTCAAAAAAAGCCCGTCTTCGTCTAC
CGATTCATTGCAGGCGGGACTTTCGAAGAGGTCATGTACAACAAAGCCGTCTTCAAAACCCAGCTTGCTTTCCGT
GTCGTCGACAAGAAAAACCCAATCCGCCTAGCCACCAAGTCCCTCGGAGAGTATCTCTTCCCAGCGAAGCAAACA
CCACAGCAAGACGTCACAGAGTGTCTCGGAAAGGATCCAGAAGTTCTAGACAAGATCATCCGCGCAGACGCTCAC
ACCGATGAAAACCAAAGACTGATTCGAAAGATCAAACTCACGGAGCTGTTCCAAAAGGACGACAACGACAAGTTG
ACCGAGGATGAGAAAAATGCTGCTCAGCAGCAACTCGATGATGAGCGGCTCAAGCGGACTGATTACGAAGCCTAC
CAGAGGATGATCATCGAAAGACAAAGAAGGGCCTTAGCACAGGGCACCGGGCCTTATGGCACAACTCCAGCAATG
CTTTCTGGCCAACTGCCGTCTCAGCTACCTCCACAGCCTTTTGCGCCTCAGCCACCTGCACCTGCACCCCAGCTT
ACTGTCCCAGCTAGTGCACACAATGTTGGCCCTCCGGCTCTGGCTCCAGACACAAGCATCACGCAACAAGCTCCG
CAAACTCCCGTAGCGATCCCTGGCCTGACGTTGACCAGTCCGGATCAGGCCCATGCTCAGAGCACTCCTGTGACG
CCAGGAAACAACACTAATTCCAGTCTCCTTACTCACAACACCTCTGCTACAGCTGCATCAGCACAAACTTACAAC
GGCGGTGGCAGCACTACCGAGGGCTCAAGCGCGATAAGAGATCGATCAGAGTCACCTGAAGCTTTGCAGGATCAT
AATAAGCCAAGCTGCAGGCCTCAGTGA
Transcript >Ani_SJS100_1|g8721.t1
ATGGAGCCTGGCGGAGACCCTCTAGATTGGACGGTCGATGAAGTGGTGCAATTCCTATGTCGAAACCCGCAGACA
CCATGGTCTCGGTCATCATCGCGTGCTCCACGACCGGACCCTATCACCTTTGAAGCTACGCTTCGGGATAATGAA
ATCACCGGCGAGGTGCTGATGCATGATGTAGACAAAGAGACACTACGGGAGGACCTTGGCGTGAGAGCTCTTGGC
CATCGTAGCTCTATACTCATGGCAATACGCTATATCCAGCGAAAGTCTCTCAAGTTCCAGGAATCCAGAAATCTA
GGCACTTTGTCTGAAGACCACATCGACTACGCGAACCCGGTTGTCCCTCGACTAGACTCCCCAGTGTACCATCTG
CCTCCGTCTCACAATGTGACACCACAACAAGGGCTTCACCAAAGTGCTCGTCTTCAGACTTCTTCACCCAAGGCC
TCGCCGCAGGAGCCTTCCGGGGACGTCCCCAAAGCTGATTCTGAACGTAGAGCTGGTTTTGTGGAGCATCACAAG
CCAAGCGAGGCTGCAAGTCGCCCAGGTATCTTACAGAGAAATGAGGGAAACGCCTGGTCATCTTCAGAACAACCA
CCGGAAGGACGCATTCGGCCTGGTGAAGATTTGGTTGTCGATGCCCATGGCAAGAAACGACGAAAGCTAAATCTT
AGTGCCATGACTCAGGACGAGACTGGCCCTGATGTTTCAAGACAGACAAACAGACCTAAAAGTCCCAAAGAGTGG
TACCTGGGTCCAGAAAAGCTCAATGTTTCCAGACTTTTCTATACATCTGACCCGGACTCCGACCCAGCAGAACAT
GACCAAACCTTCTCAATGATCGCCTCCAGACTTCCAGCTGGCCGGCGCAGATTCGTGAACCAGAGGCTTATCTAT
TTCCACAAGCAGCGGCCCGTGAAGCTAAGCTCCACGCAGTCAGCATTGGTTCCTTATCGAGAATTGACCAAGCAA
AAAAGTAAGCCAACGAAGAAGGAAGTAGTCATAGGCCATAGCAACCCAAGGCCTTGCACCTTGTATACTGTGCAT
AATGGCAGAGTCACAGTCACTAGAGACGAACTACAGAGGTGGCCGCAATTAGTTCAGTCGGAGGAGGCCGATAGC
GGGGGCGCAAAGGACCATGATCCCTTTGCCTACCTGTTACAAAAATACCCCGCACAAAATGATGATGATGATGGC
CTTGATACTCTTCCCCTCTATGGAGACTCAGGATCGGAGGGTGAGTTCGATGATGACATATGGCAGGAAATTGAG
GATGAACGCCGGGAACCATTGCCACGGCAAACAACCCTCACATCTGCTGAGATTAAATCTATCATTGCAAGTTGC
ATTTCAGAATATGAGAACAACTGGCTGCAAGATGGAAGGACAAGAGAGGAGCCAAAGGCACGAAGAATTTGGTTA
TCTTCTAGGAGAGGTAAAACCACTAATGAACAAATCAAGACTATCACCCGCGACGTTAGTCTTCTAGAACGGCGT
CTAGGTGTATTCACGAAAGCAATAGAGGAAAGTGAATATGCATCACGGAAAGAGCTACAAGTACAATGCCGGAGT
CTGGAGAACACCGTCATCAACATCCAGAAGCAAAAGTGGCTTATATCGGTTCTTGAACTCGAGCAGTGTCCGCCG
AAGATGGCTTACCCTACGAGGCCTTTGCCTCCCATAAGGCAAAGCATTGACGAGGATGGAGAGTCGCTTGGCTCG
GAAACCGATCATGGCGCTGTTGATGATGACTCTCTTGACGATTTCATTGAGGATGACGTTTTCCGCAAAAGCCCT
ACCCCTTCGTCGGACGACGATGATATCATTAGTCCTTCTGGAAAAAGGCGAAGATTCAGGACTACAGCACATCCT
TTCGTTGAGTCCAGTTCCCCCTCCCCTCCGCCACTTCCTGAAGGACCAATAGAGACTATTGACCTGACTGGCGAT
GATCCACTGCCTGAAGAGGATGACTTTACCGTTGAGACGCCCCCATTGAACCCAGCGCGACAGACGCCGCAATCT
GAACACGTCTTGTCAAGAGAAATCTCTCCTGCACCAAAGCTTCCTCCTAAAGTGTATGTCGAGATACCGAATGTC
GTGATACCGGAAACCGAGATACCGACACCATCGAAACAAGATGGCATCGCACAGTCAGTTGCAAGTTCCGCAAGG
CCTCATCTAGACAGTTTAGAGGACCTGCCCGAAATCAACGATTTTAACAAGCTCAAGGGAATCGGTTGGAGGCTC
TTGGAGGAGCGTTATGACCGTTGCAGACTCCTGGCAAAGTTGATAGCATCACTCGCAGATGAAGAACGACAGAGA
TTGACTAGGATGGTTCCGACATATGACGTAAAAAGCCTGCAAAGCCTCACAAACACGGCTTTGAAAAGACTGTGG
AAAAGCAAGGAAACAATATCAGGGCTGACACCTGATGAGGCTAGTTTTGCCATGCGCACGGCATCCCTCTTTATT
TCATGGATAAATTGCGCACATTACCACGTGAAGGGCTTCCCAAAAACCCATGTTTGGGAGGCAAAAGAACGTGTC
TCGGATTTCCCCGAGTTTTACAAGGAACTCTCCTGCCGCTTGGATGCGTATCAAACCTGGGATATAAACCGGCAA
CAGACCGCCGTGACTGCTTTTGACTCACCCCACAAGAAAAGGAAACGGGAAGTGAAGGAGAGCCAAGCCGCAAAA
ATGAATCAAGAAATCGCCAAACTTCGTGTTGCTCATCAAGAGAAGTTGAGGCAGAAGCTTGAACGCAGATTGGAA
AGCATGGGTGTCAGCAATACCGATGCCACTCGCCAGGCTGTCAGTTTTGGCGATCCTGTCATCTACTTGGACCCT
CATATCGGACAGCGTGTCAAGCCTCATCAATTGCATGGCATCCAATTTATGTGGCGAGAACTGACTGAGGATGGT
GGAAAACATCAGGGCTGTCTCCTTGCTCATACAATGGGCTTGGGTAAAACGATGCAGGTCATCTCCCTCCTTGTG
ACTATAGCGAATGCGGCTGCTTCTGAGAACCCTTGGATAAAGAAGCAAATCCCAGACAACCTCCTTCGATCCCAG
ACTCTTATTCTTTGCCCGTCGTCACTGATCGAGAACTGGTACGAAGAGTTCATTATGTGGACCCCTAAGGATTCG
GCCATCGGGCCTGTCAACAAAGTGACCAGCTCGGCTTCTCTCGCGGAAAGGCTGAACACTGTGGCTCTTTGGAAT
GAAGAAGGCGGAGTACTTCTTATCAGCTATGACATATTTCGGACATGGATCTATAATAAAGAAACAATCAGGAGA
GGCAAGCCTCTCTCGGAAGAGGAGCATGAGAACATTAAGAAGTGGCTTCTAGAAGGAGCTAACATCATTGTTGCT
GATGAAGCCCATAAGATGAAGAACCCAGCTTCTGCAATTACTCTTGCGGCCATGCAGTTCCGCTCTCAGAGCCGC
ATTGCATTGACTGGCTCTCCTCTTGCGAATAATCTTGTGGATTACTTTACCATGGTCAACTGGATTGCAGGAGGT
TATCTGGGAGAGTTCACAGAGTTCAAGGCTAACTTTGTAGAGCCTATTGAGGAAGGTCTGTACGTGGATAGCACA
CATAGCGAGCGGCGGCGGTCTCTTGTGAAGCTTCAGGTCCTGAACAAGATTCTTGAACCAAAGATCAACCGGGCT
GATATCTCTGTCCTTGAGGGCAGCTTGCCCCCCAAGGTCGAATTCGTCATTACTGTTCCATTAACGGATGTGCAA
AAGTCTGCATACGATCTATACGTGCAGTCGATTCTAGAGGGCAGCCAGGATTTTAGCAGGATGAAGCTACTGTCT
TGGCTAGCCGTGCTAGGTCTGTGTTGCAATCACCCAGCTTGTTTCAGAGATAAGCTTCTCAGCAGAGCCAGCGAT
GCTCAGAAGCTCGATAGAATGATAGACGGCGCCGCGATCGAACCAGCCCCTGGTGACGAGCCTATCACGCAGCTG
GGACTGGACGTTGAGGGTCTCGTTTCAAAACAAGAGCAGCTTTTCTCTACTGTTCCTGACATGAGCGCCGCAACA
CTGTCAAGTCGAGCCGAAATTTTGAACAGGATCATCGCAGAGTCTGTCCGGGCTGGAGATAAAGTGCTTGTGTTT
TCACACAGCATACCTACGCTCAACTACGTCGAGAATGATATTCTCAAGGCATTTGGTTGGAAATATTGCCGTCTA
GATGGAAGCACTCCAATGGCCAGCCGACAAGCTGCTACCAAGCAGTTCAATCAAGGCTCTGCAGAGGATGTATAC
CTAATTTCCACCCGTGCCGGCGGCCTAGGCCTAAACATCTTCGGTGCTAACCGTGTCATCATTTTCGACTTCACA
TTCAATCCCGTCTGGGAGGAACAGGCCGTCGGACGTGCCTATCGCTTAGGTCAAAAAAAGCCCGTCTTCGTCTAC
CGATTCATTGCAGGCGGGACTTTCGAAGAGGTCATGTACAACAAAGCCGTCTTCAAAACCCAGCTTGCTTTCCGT
GTCGTCGACAAGAAAAACCCAATCCGCCTAGCCACCAAGTCCCTCGGAGAGTATCTCTTCCCAGCGAAGCAAACA
CCACAGCAAGACGTCACAGAGTGTCTCGGAAAGGATCCAGAAGTTCTAGACAAGATCATCCGCGCAGACGCTCAC
ACCGATGAAAACCAAAGACTGATTCGAAAGATCAAACTCACGGAGCTGTTCCAAAAGGACGACAACGACAAGTTG
ACCGAGGATGAGAAAAATGCTGCTCAGCAGCAACTCGATGATGAGCGGCTCAAGCGGACTGATTACGAAGCCTAC
CAGAGGATGATCATCGAAAGACAAAGAAGGGCCTTAGCACAGGGCACCGGGCCTTATGGCACAACTCCAGCAATG
CTTTCTGGCCAACTGCCGTCTCAGCTACCTCCACAGCCTTTTGCGCCTCAGCCACCTGCACCTGCACCCCAGCTT
ACTGTCCCAGCTAGTGCACACAATGTTGGCCCTCCGGCTCTGGCTCCAGACACAAGCATCACGCAACAAGCTCCG
CAAACTCCCGTAGCGATCCCTGGCCTGACGTTGACCAGTCCGGATCAGGCCCATGCTCAGAGCACTCCTGTGACG
CCAGGAAACAACACTAATTCCAGTCTCCTTACTCACAACACCTCTGCTACAGCTGCATCAGCACAAACTTACAAC
GGCGGTGGCAGCACTACCGAGGGCTCAAGCGCGATAAGAGATCGATCAGAGTCACCTGAAGCTTTGCAGGATCAT
AATAAGCCAAGCTGCAGGCCTCAGTGA
Gene >Ani_SJS100_1|g8721.t1
ATGGAGCCTGGCGGAGACCCTCTAGATTGGACGGTCGATGAAGTGGTGCAATTCCTATGTCGAAACCCGCAGACA
CCATGGTCTCGGTCATCATCGCGTGCTCCACGACCGGACCCTATCACCTTTGAAGCTACGCTTCGGGATAATGAA
ATCACCGGCGAGGTGCTGATGCATGATGTAGACAAAGAGACACTACGGGAGGACCTTGGCGTGAGAGCTCTTGGC
CATCGTAGCTCTATACTCATGGCAATACGCTATATCCAGCGAAAGTCTCTCAAGTTCCAGGAATCCAGAAATCTA
GGCACTTTGTCTGAAGACCACATCGACTACGCGAACCCGGTTGTCCCTCGACTAGACTCCCCAGTGTACCATCTG
CCTCCGTCTCACAATGTGACACCACAACAAGGGCTTCACCAAAGTGCTCGTCTTCAGACTTCTTCACCCAAGGCC
TCGCCGCAGGAGCCTTCCGGGGACGTCCCCAAAGCTGATTCTGAACGTAGAGCTGGTTTTGTGGAGCATCACAAG
CCAAGCGAGGCTGCAAGTCGCCCAGGTATCTTACAGAGAAATGAGGGAAACGCCTGGTCATCTTCAGAACAACCA
CCGGAAGGACGCATTCGGCCTGGTGAAGATTTGGTTGTCGATGCCCATGGCAAGAAACGACGAAAGCTAAATCTT
AGTGCCATGACTCAGGACGAGACTGGCCCTGATGTTTCAAGACAGACAAACAGACCTAAAAGTCCCAAAGAGTGG
TACCTGGGTCCAGAAAAGCTCAATGTTTCCAGACTTTTCTATACATCTGACCCGGACTCCGACCCAGCAGAACAT
GACCAAACCTTCTCAATGATCGCCTCCAGACTTCCAGCTGGCCGGCGCAGATTCGTGAACCAGAGGCTTATCTAT
TTCCACAAGCAGCGGCCCGTGAAGCTAAGCTCCACGCAGTCAGCATTGGTTCCTTATCGAGAATTGACCAAGCAA
AAAAGTAAGCCAACGAAGAAGGAAGTAGTCATAGGCCATAGCAACCCAAGGCCTTGCACCTTGTATACTGTGCAT
AATGGCAGAGTCACAGTCACTAGAGACGAACTACAGAGGTGGCCGCAATTAGTTCAGTCGGAGGAGGCCGATAGC
GGGGGCGCAAAGGACCATGATCCCTTTGCCTACCTGTTACAAAAATACCCCGCACAAAATGATGATGATGATGGC
CTTGATACTCTTCCCCTCTATGGAGACTCAGGATCGGAGGGTGAGTTCGATGATGACATATGGCAGGAAATTGAG
GATGAACGCCGGGAACCATTGCCACGGCAAACAACCCTCACATCTGCTGAGATTAAATCTATCATTGCAAGTTGC
ATTTCAGAATATGAGAACAACTGGCTGCAAGATGGAAGGACAAGAGAGGAGCCAAAGGCACGAAGAATTTGGTTA
TCTTCTAGGAGAGGTAAAACCACTAATGAACAAATCAAGACTATCACCCGCGACGTTAGTCTTCTAGAACGGCGT
CTAGGTGTATTCACGAAAGCAATAGAGGAAAGTGAATATGCATCACGGAAAGAGCTACAAGTACAATGCCGGAGT
CTGGAGAACACCGTCATCAACATCCAGAAGCAAAAGTGGCTTATATCGGTTCTTGAACTCGAGCAGTGTCCGCCG
AAGATGGCTTACCCTACGAGGCCTTTGCCTCCCATAAGGCAAAGCATTGACGAGGATGGAGAGTCGCTTGGCTCG
GAAACCGATCATGGCGCTGTTGATGATGACTCTCTTGACGATTTCATTGAGGATGACGTTTTCCGCAAAAGCCCT
ACCCCTTCGTCGGACGACGATGATATCATTAGTCCTTCTGGAAAAAGGCGAAGATTCAGGACTACAGCACATCCT
TTCGTTGAGTCCAGTTCCCCCTCCCCTCCGCCACTTCCTGAAGGACCAATAGAGACTATTGACCTGACTGGCGAT
GATCCACTGCCTGAAGAGGATGACTTTACCGTTGAGACGCCCCCATTGAACCCAGCGCGACAGACGCCGCAATCT
GAACACGTCTTGTCAAGAGAAATCTCTCCTGCACCAAAGCTTCCTCCTAAAGTGTATGTCGAGATACCGAATGTC
GTGATACCGGAAACCGAGATACCGACACCATCGAAACAAGATGGCATCGCACAGTCAGTTGCAAGTTCCGCAAGG
CCTCATCTAGACAGTTTAGAGGACCTGCCCGAAATCAACGATTTTAACAAGCTCAAGGGAATCGGTTGGAGGCTC
TTGGAGGAGCGTTATGACCGTTGCAGACTCCTGGCAAAGTTGATAGCATCACTCGCAGATGAAGAACGACAGAGA
TTGACTAGGATGGTTCCGACATATGACGTAAAAAGCCTGCAAAGCCTCACAAACACGGCTTTGAAAAGACTGTGG
AAAAGCAAGGAAACAATATCAGGGCTGACACCTGATGAGGCTAGTTTTGCCATGCGCACGGCATCCCTCTTTATT
TCATGGATAAATTGCGCACATTACCACGTGAAGGGCTTCCCAAAAACCCATGTTTGGGAGGCAAAAGAACGTGTC
TCGGATTTCCCCGAGTTTTACAAGGAACTCTCCTGCCGCTTGGATGCGTATCAAACCTGGGATATAAACCGGCAA
CAGACCGCCGTGACTGCTTTTGACTCACCCCACAAGAAAAGGAAACGGGAAGTGAAGGAGAGCCAAGCCGCAAAA
ATGAATCAAGAAATCGCCAAACTTCGTGTTGCTCATCAAGAGAAGTTGAGGCAGAAGCTTGAACGCAGATTGGAA
AGCATGGGTGTCAGCAATACCGATGCCACTCGCCAGGCTGTCAGTTTTGGCGATCCTGTCATCTACTTGGACCCT
CATATCGGACAGCGTGTCAAGCCTCATCAATTGCATGGCATCCAATTTATGTGGCGAGAACTGACTGAGGATGGT
GGAAAACATCAGGGCTGTCTCCTTGCTCATACAATGGGCTTGGGTAAAACGATGCAGGTCATCTCCCTCCTTGTG
ACTATAGCGAATGCGGCTGCTTCTGAGAACCCTTGGATAAAGAAGCAAATCCCAGACAACCTCCTTCGATCCCAG
ACTCTTATTCTTTGCCCGTCGTCACTGATCGAGAACTGGTACGAAGAGTTCATTATGTGGACCCCTAAGGATTCG
GCCATCGGGCCTGTCAACAAAGTGACCAGCTCGGCTTCTCTCGCGGAAAGGCTGAACACTGTGGCTCTTTGGAAT
GAAGAAGGCGGAGTACTTCTTATCAGCTATGACATATTTCGGACATGGATCTATAATAAAGAAACAATCAGGAGA
GGCAAGCCTCTCTCGGAAGAGGAGCATGAGAACATTAAGAAGTGGCTTCTAGAAGGAGCTAACATCATTGTTGCT
GATGAAGCCCATAAGATGAAGAACCCAGCTTCTGCAATTACTCTTGCGGCCATGCAGTTCCGCTCTCAGAGCCGC
ATTGCATTGACTGGCTCTCCTCTTGCGAATAATCTTGTGGATTACTTTACCATGGTCAACTGGATTGCAGGAGGT
TATCTGGGAGAGTTCACAGAGTTCAAGGCTAACTTTGTAGAGCCTATTGAGGAAGGTCTGTACGTGGATAGCACA
CATAGCGAGCGGCGGCGGTCTCTTGTGAAGCTTCAGGTCCTGAACAAGATTCTTGAACCAAAGATCAACCGGGCT
GATATCTCTGTCCTTGAGGGCAGCTTGCCCCCCAAGGTCGAATTCGTCATTACTGTTCCATTAACGGATGTGCAA
AAGTCTGCATACGATCTATACGTGCAGTCGATTCTAGAGGGCAGCCAGGATTTTAGCAGGATGAAGCTACTGTCT
TGGCTAGCCGTGCTAGGTCTGTGTTGCAATCACCCAGCTTGTTTCAGAGATAAGCTTCTCAGCAGAGCCAGCGAT
GCTCAGAAGCTCGATAGAATGATAGACGGCGCCGCGATCGAACCAGCCCCTGGTGACGAGCCTATCACGCAGCTG
GGACTGGACGTTGAGGGTCTCGTTTCAAAACAAGAGCAGCTTTTCTCTACTGTTCCTGACATGAGCGCCGCAACA
CTGTCAAGTCGAGCCGAAATTTTGAACAGGATCATCGCAGAGTCTGTCCGGGCTGGAGATAAAGTGCTTGTGTTT
TCACACAGCATACCTACGCTCAACTACGTCGAGAATGATATTCTCAAGGCATTTGGTTGGAAATATTGCCGTCTA
GATGGAAGCACTCCAATGGCCAGCCGACAAGCTGCTACCAAGCAGTTCAATCAAGGCTCTGCAGAGGATGTATAC
CTAATTTCCACCCGTGCCGGCGGCCTAGGCCTAAACATCTTCGGTGCTAACCGTGTCATCATTTTCGACTTCACA
TTCAATCCCGTCTGGGAGGAACAGGCCGTCGGACGTGCCTATCGCTTAGGTCAAAAAAAGCCCGTCTTCGTCTAC
CGATTCATTGCAGGCGGGACTTTCGAAGAGGTCATGTACAACAAAGCCGTCTTCAAAACCCAGCTTGCTTTCCGT
GTCGTCGACAAGAAAAACCCAATCCGCCTAGCCACCAAGTCCCTCGGAGAGTATCTCTTCCCAGCGAAGCAAACA
CCACAGCAAGACGTCACAGAGTGTCTCGGAAAGGATCCAGAAGTTCTAGACAAGATCATCCGCGCAGACGCTCAC
ACCGATGAAAACCAAAGACTGATTCGAAAGATCAAACTCACGGAGCTGTTCCAAAAGGACGACAACGACAAGTTG
ACCGAGGATGAGAAAAATGCTGCTCAGCAGCAACTCGATGATGAGCGGCTCAAGCGGACTGATTACGAAGCCTAC
CAGAGGATGATCATCGAAAGACAAAGAAGGGCCTTAGCACAGGGCACCGGGCCTTATGGCACAACTCCAGCAATG
CTTTCTGGCCAACTGCCGTCTCAGCTACCTCCACAGCCTTTTGCGCCTCAGCCACCTGCACCTGCACCCCAGCTT
ACTGTCCCAGCTAGTGCACACAATGTTGGCCCTCCGGCTCTGGCTCCAGACACAAGCATCACGCAACAAGCTCCG
CAAACTCCCGTAGCGATCCCTGGCCTGACGTTGACCAGTCCGGATCAGGCCCATGCTCAGAGCACTCCTGTGACG
CCAGGAAACAACACTAATTCCAGTCTCCTTACTCACAACACCTCTGCTACAGCTGCATCAGCACAAACTTACAAC
GGCGGTGGCAGCACTACCGAGGGCTCAAGCGCGATAAGAGATCGATCAGAGTCACCTGAAGCTTTGCAGGATCAT
AATAAGCCAAGCTGCAGGCCTCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail