Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g8449.t1
Gene name
Locationscaffold_066:192881..193875
Strand-
Gene length (bp)994
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05153 MIOX Myo-inositol oxygenase 2.4E-123 61 309

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0019310 inositol catabolic process Yes
GO:0050113 inositol oxygenase activity Yes
GO:0005506 iron ion binding Yes
GO:0006020 inositol metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043169 cation binding No
GO:0009056 catabolic process No
GO:0004497 monooxygenase activity No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0046174 polyol catabolic process No
GO:0019751 polyol metabolic process No
GO:0003674 molecular_function No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:1901615 organic hydroxy compound metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043167 ion binding No
GO:0016052 carbohydrate catabolic process No
GO:0044248 cellular catabolic process No
GO:0044282 small molecule catabolic process No
GO:1901575 organic substance catabolic process No
GO:0016491 oxidoreductase activity No
GO:0046164 alcohol catabolic process No
GO:0005488 binding No
GO:0005575 cellular_component No
GO:0006066 alcohol metabolic process No
GO:0046872 metal ion binding No
GO:0044281 small molecule metabolic process No
GO:0003824 catalytic activity No
GO:0044262 cellular carbohydrate metabolic process No
GO:1901616 organic hydroxy compound catabolic process No
GO:0008150 biological_process No
GO:0044275 cellular carbohydrate catabolic process No
GO:0044237 cellular metabolic process No
GO:0046914 transition metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup8610
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g5924.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g9227.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g6559.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g6581.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g7495.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g6815.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g4781.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g11094.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g10976.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g5441.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7521.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g2996.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g8541.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g7730.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g8031.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g7776.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g6754.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g10855.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g6932.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g8449.t1 (this protein)
Aspergillus niger CBS 147371 Ani_SJS27_1|g11093.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g11124.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g7179.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g6155.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g8449.t1
MPSVEISLAPTNIEATSDMIDAVNVLRAKNTDPATSKNLYDDSEFDKAKDKTTFRQFNDACDRVKNFYAQQHTLQ
TVAYNLKARHNFHNKTRAHMTVWEAIEKLNTFIDECDPDTQESQMTHLLQSAEAIRQEGKPRWMQLVGLIHDLGK
LLFFFGAQGQWDVVGDTFPVGCAFDDRIIFGTESFKNNEDIKNPIYNTKFGIYSPGCGLENVMLCWGHDEYLYHI
VKDQSTIPDEGLAMIRYHSFYPWHRENAYHELMNEHDKKMLAAVRAFNPYDLYSKSDSVPDPVKLKPYYLELIDE
YFPNKVLRW*
Coding >Ani_SJS100_1|g8449.t1
ATGCCATCTGTCGAGATTTCGCTGGCTCCAACCAACATCGAAGCCACCTCCGACATGATCGATGCAGTGAACGTC
CTAAGAGCCAAGAACACCGACCCCGCAACATCGAAAAATCTATACGACGACTCCGAGTTTGACAAAGCCAAAGAC
AAGACTACCTTCCGCCAATTCAACGATGCTTGTGACCGTGTGAAGAACTTCTACGCGCAGCAACACACCCTACAA
ACCGTAGCTTACAACCTGAAAGCCCGACACAACTTTCACAACAAGACGCGAGCCCATATGACCGTCTGGGAAGCC
ATTGAGAAGCTCAACACCTTCATCGATGAATGTGACCCCGATACCCAGGAGTCACAGATGACGCACCTTCTTCAG
TCTGCTGAAGCAATTCGCCAGGAGGGAAAGCCGCGCTGGATGCAACTTGTCGGATTGATTCATGATCTGGGAAAG
TTGCTTTTCTTCTTCGGCGCACAGGGTCAGTGGGATGTCGTGGGCGATACGTTTCCTGTTGGATGTGCTTTTGAT
GATCGCATCATTTTTGGTACGGAATCTTTCAAAAACAATGAGGACATCAAGAACCCGATCTACAATACCAAGTTT
GGGATCTATTCTCCTGGCTGTGGACTGGAGAATGTCATGCTTTGCTGGGGTCATGATGAATACTTGTATCACATT
GTCAAAGATCAGTCGACTATTCCTGATGAAGGTCTTGCGATGATCAGATATCACTCGTTCTATCCCTGGCACCGG
GAGAATGCTTACCACGAGTTGATGAATGAGCATGATAAGAAAATGCTTGCGGCGGTGCGGGCTTTTAACCCTTAT
GATTTGTACAGCAAGAGCGATAGCGTGCCGGATCCAGTGAAGCTGAAGCCTTACTATCTCGAGCTGATTGACGAA
TACTTCCCTAACAAAGTGCTCCGCTGGTAA
Transcript >Ani_SJS100_1|g8449.t1
ATGCCATCTGTCGAGATTTCGCTGGCTCCAACCAACATCGAAGCCACCTCCGACATGATCGATGCAGTGAACGTC
CTAAGAGCCAAGAACACCGACCCCGCAACATCGAAAAATCTATACGACGACTCCGAGTTTGACAAAGCCAAAGAC
AAGACTACCTTCCGCCAATTCAACGATGCTTGTGACCGTGTGAAGAACTTCTACGCGCAGCAACACACCCTACAA
ACCGTAGCTTACAACCTGAAAGCCCGACACAACTTTCACAACAAGACGCGAGCCCATATGACCGTCTGGGAAGCC
ATTGAGAAGCTCAACACCTTCATCGATGAATGTGACCCCGATACCCAGGAGTCACAGATGACGCACCTTCTTCAG
TCTGCTGAAGCAATTCGCCAGGAGGGAAAGCCGCGCTGGATGCAACTTGTCGGATTGATTCATGATCTGGGAAAG
TTGCTTTTCTTCTTCGGCGCACAGGGTCAGTGGGATGTCGTGGGCGATACGTTTCCTGTTGGATGTGCTTTTGAT
GATCGCATCATTTTTGGTACGGAATCTTTCAAAAACAATGAGGACATCAAGAACCCGATCTACAATACCAAGTTT
GGGATCTATTCTCCTGGCTGTGGACTGGAGAATGTCATGCTTTGCTGGGGTCATGATGAATACTTGTATCACATT
GTCAAAGATCAGTCGACTATTCCTGATGAAGGTCTTGCGATGATCAGATATCACTCGTTCTATCCCTGGCACCGG
GAGAATGCTTACCACGAGTTGATGAATGAGCATGATAAGAAAATGCTTGCGGCGGTGCGGGCTTTTAACCCTTAT
GATTTGTACAGCAAGAGCGATAGCGTGCCGGATCCAGTGAAGCTGAAGCCTTACTATCTCGAGCTGATTGACGAA
TACTTCCCTAACAAAGTGCTCCGCTGGTAA
Gene >Ani_SJS100_1|g8449.t1
ATGCCATCTGTCGAGATTTCGCTGGCTCCAACCAACATCGAAGCCACCTCCGACATGATCGATGCAGTGAACGTC
CTAAGAGCCAAGAACACCGACCCCGCAACATCGAAAAATCTATACGACGACTCCGAGTTTGACAAAGCCAAAGAC
AAGACTACCTTCCGCCAATTCAACGATGCTTGTGACCGTGTGAAGAACTTCTACGCGCAGCAACACACCCTACAA
ACCGTAGCTTACAACCTGAAAGCCCGACACAACTTTCACAACAAGACGCGAGCCCATATGACCGTCTGGGAAGCC
ATTGAGAAGCTCAACACCTTCATCGATGAATGTGACCCCGATACCCAGGAGTCACAGATGACGCACCTTCTTCAG
TCTGCTGAAGCAATTCGCCAGGAGGGAAAGCCGCGCTGGATGCAACTTGTCGGATTGATTCATGATCTGGGAAAG
TTGCTTTTCTTCTTCGGCGCACAGGGTCAGTGGGATGTCGTGGGCGATACGTTTCCTGTTGGATGTGCTTTTGAT
GATCGCATCATTTTTGGTACGGAATCTTTCAAAAACAATGAGGACATCAAGAACCCGATCTACAATACCAAGTTT
GGGATCTATTCTCCTGGCTGTGGACTGGAGAATGTCATGCTTTGCTGGGGTCATGATGAATACTTGTATCACATT
GTCAAAGATCAGTCGACTATTCCTGATGAAGGTCTTGCGATGATCAGATATCACTCGTTCTATCCCTGGCACCGG
GAGAATGCTTACCACGAGTTGATGAATGAGCATGATAAGAAAATGCTTGCGGCGGTGCGGGCTTTTAACCCTTAT
GATTTGTACAGCAAGAGCGATAGCGTGCCGGATCCAGTGAAGCTGAAGGTGAGAATACCCAGAGCTCTTCCATGT
GAGGTATTGCCACTAACACTGGTTCTTAAATGAAAAGCCTTACTATCTCGAGCTGATTGACGAATACTTCCCTAA
CAAAGTGCTCCGCTGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail