Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g8407.t1
Gene name
Locationscaffold_066:80131..82256
Strand-
Gene length (bp)2125
Transcript length (bp)2055
Coding sequence length (bp)2055
Protein length (aa) 685

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07676 PD40 WD40-like Beta Propeller Repeat 7.5E-05 75 104
PF07676 PD40 WD40-like Beta Propeller Repeat 5.4E-03 124 151
PF07676 PD40 WD40-like Beta Propeller Repeat 2.0E-06 184 202
PF07676 PD40 WD40-like Beta Propeller Repeat 1.1E-02 242 258
PF07676 PD40 WD40-like Beta Propeller Repeat 2.9E-02 355 368
PF07676 PD40 WD40-like Beta Propeller Repeat 5.1E-05 557 591

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g8407.t1
MHVTKTWAWLALATATLVSGASHYEGQGHAARRAASDTYKGTFLHNRISPNYSELYIAEPDGSNAKLLLGSNSVY
DFRASWSPDAKHVYFTSERRGDGQADIYRVAINGTSTVGAEVEPVALSPGVDDSASISPDGKMLAFATSRYNQTS
QIMLMVLETGSLKNLTLIPGISEAANSALPNGYFKPTWSPDGEWIVFTSDRNTPWRGHSDGSGWEHTQELSIYAA
RPNGTDFRLVSSRSNYTQGSPRFSPNGKRLVFYEMLTEDTYNGRLQPELLEGSYLNTSIVSIDFATGGDRIVHAT
GDGTKISPSFVTDDVIGYVMKESASNGIYYTSLSGKNYTQYQTIPMNTMTPALRSPAWSPDGKYVIYEKQGPTGG
STSTSKKQYSDLWNFDPDWDYRFTDVFPMAKRGGCPMMAMSQQMEGVAESNLMRLQMNGTDQVTLFETKKGMINP
SIAEGFNARAYQGSWGPNDTNITFGYGAYFVGRQSSPGFIFSVTPEGTGVTLLAGNNITNYGFPSYNYDGTQVVF
RTWPGTASNGTTVGTTGLAIVDLPSRQVTQLTTEWDNLPAFSPDGKKILFTRRTNLDNIGDNYDIFTMNPDGSEL
TKLTPSIASDAHAVWTQDGRILYSTAMFGFQQEAPLYDDSMQPYAIIMLMEADGSNKTALSNSLWEDAMPMFAPA
HVMESDCCS*
Coding >Ani_SJS100_1|g8407.t1
ATGCATGTTACGAAGACATGGGCCTGGCTTGCATTAGCCACTGCCACGCTGGTCTCTGGTGCGTCACACTATGAA
GGCCAGGGTCATGCCGCTAGAAGAGCAGCCTCAGACACATATAAGGGGACCTTTCTACACAATCGCATCAGTCCC
AACTACTCCGAGCTGTACATTGCCGAACCAGATGGCTCTAACGCGAAGCTCCTCCTTGGTTCCAACAGCGTGTAC
GATTTCCGAGCAAGCTGGTCTCCTGATGCCAAACATGTTTATTTCACGTCAGAAAGAAGAGGGGACGGCCAGGCG
GACATTTACCGCGTGGCCATAAATGGCACGAGCACGGTGGGAGCAGAAGTCGAACCTGTCGCCTTGTCACCAGGT
GTCGACGACTCTGCTTCAATCTCCCCTGATGGCAAGATGCTGGCGTTTGCAACTTCGAGATACAATCAGACCAGT
CAGATCATGCTGATGGTCCTGGAAACGGGATCTCTCAAGAACCTGACGCTCATTCCTGGTATCTCCGAAGCTGCC
AACTCCGCACTACCCAATGGATACTTCAAGCCGACATGGTCCCCCGATGGAGAGTGGATTGTCTTCACGTCCGAT
CGTAACACACCATGGCGTGGCCACAGCGACGGTTCGGGATGGGAGCATACCCAGGAGTTGTCCATCTACGCAGCC
CGCCCTAATGGCACCGACTTCCGACTGGTGTCGTCTCGGAGCAACTACACCCAAGGCTCGCCTAGGTTCTCGCCG
AATGGAAAGCGCCTGGTCTTCTACGAGATGCTGACCGAGGACACGTACAATGGTCGTCTACAGCCTGAACTGCTT
GAAGGTTCTTATCTTAACACCAGCATCGTCTCAATCGATTTCGCCACTGGAGGTGACCGTATCGTTCATGCCACT
GGAGATGGCACCAAGATTAGCCCTTCATTTGTCACCGATGATGTTATTGGCTATGTTATGAAAGAGTCAGCCAGC
AACGGTATCTACTACACGTCTCTCTCGGGCAAAAATTACACGCAGTACCAGACCATTCCCATGAACACCATGACA
CCTGCACTACGCTCCCCTGCGTGGTCGCCAGATGGCAAATATGTCATCTATGAGAAGCAGGGTCCCACGGGCGGT
AGTACATCGACTTCCAAGAAGCAATACTCCGACCTGTGGAACTTCGACCCGGATTGGGACTACCGCTTCACGGAT
GTCTTCCCCATGGCCAAGCGTGGAGGCTGCCCTATGATGGCCATGTCCCAGCAGATGGAGGGTGTCGCGGAGAGC
AATCTCATGCGCCTCCAAATGAACGGCACTGATCAGGTCACTCTCTTCGAGACCAAAAAGGGCATGATCAATCCA
TCCATTGCAGAAGGCTTCAACGCCCGTGCCTACCAGGGCAGCTGGGGGCCCAATGATACGAACATCACGTTCGGC
TACGGTGCATACTTTGTCGGTCGTCAAAGTAGCCCCGGTTTCATTTTCAGTGTCACCCCGGAGGGCACGGGCGTG
ACGCTTCTCGCGGGCAACAACATTACCAACTACGGATTCCCGTCCTATAATTATGATGGCACTCAGGTCGTTTTC
CGAACCTGGCCTGGCACTGCCTCCAACGGTACCACTGTTGGTACGACCGGATTAGCCATTGTTGATCTACCCTCC
CGGCAGGTGACGCAGCTCACGACCGAGTGGGATAATCTTCCGGCCTTCTCTCCCGATGGCAAGAAGATTCTGTTC
ACCCGGCGCACAAACCTGGACAATATCGGCGACAACTATGACATTTTCACTATGAATCCCGACGGCAGTGAACTT
ACCAAGCTCACCCCATCTATCGCCAGTGACGCCCATGCTGTGTGGACCCAAGACGGCCGTATCCTTTACAGTACT
GCTATGTTCGGCTTCCAGCAGGAGGCACCCTTATATGATGACTCTATGCAGCCCTATGCTATCATCATGCTCATG
GAAGCCGATGGTAGTAACAAGACTGCGTTGTCCAACAGTTTGTGGGAAGATGCCATGCCTATGTTTGCGCCAGCG
CATGTAATGGAGTCCGACTGTTGTTCTTGA
Transcript >Ani_SJS100_1|g8407.t1
ATGCATGTTACGAAGACATGGGCCTGGCTTGCATTAGCCACTGCCACGCTGGTCTCTGGTGCGTCACACTATGAA
GGCCAGGGTCATGCCGCTAGAAGAGCAGCCTCAGACACATATAAGGGGACCTTTCTACACAATCGCATCAGTCCC
AACTACTCCGAGCTGTACATTGCCGAACCAGATGGCTCTAACGCGAAGCTCCTCCTTGGTTCCAACAGCGTGTAC
GATTTCCGAGCAAGCTGGTCTCCTGATGCCAAACATGTTTATTTCACGTCAGAAAGAAGAGGGGACGGCCAGGCG
GACATTTACCGCGTGGCCATAAATGGCACGAGCACGGTGGGAGCAGAAGTCGAACCTGTCGCCTTGTCACCAGGT
GTCGACGACTCTGCTTCAATCTCCCCTGATGGCAAGATGCTGGCGTTTGCAACTTCGAGATACAATCAGACCAGT
CAGATCATGCTGATGGTCCTGGAAACGGGATCTCTCAAGAACCTGACGCTCATTCCTGGTATCTCCGAAGCTGCC
AACTCCGCACTACCCAATGGATACTTCAAGCCGACATGGTCCCCCGATGGAGAGTGGATTGTCTTCACGTCCGAT
CGTAACACACCATGGCGTGGCCACAGCGACGGTTCGGGATGGGAGCATACCCAGGAGTTGTCCATCTACGCAGCC
CGCCCTAATGGCACCGACTTCCGACTGGTGTCGTCTCGGAGCAACTACACCCAAGGCTCGCCTAGGTTCTCGCCG
AATGGAAAGCGCCTGGTCTTCTACGAGATGCTGACCGAGGACACGTACAATGGTCGTCTACAGCCTGAACTGCTT
GAAGGTTCTTATCTTAACACCAGCATCGTCTCAATCGATTTCGCCACTGGAGGTGACCGTATCGTTCATGCCACT
GGAGATGGCACCAAGATTAGCCCTTCATTTGTCACCGATGATGTTATTGGCTATGTTATGAAAGAGTCAGCCAGC
AACGGTATCTACTACACGTCTCTCTCGGGCAAAAATTACACGCAGTACCAGACCATTCCCATGAACACCATGACA
CCTGCACTACGCTCCCCTGCGTGGTCGCCAGATGGCAAATATGTCATCTATGAGAAGCAGGGTCCCACGGGCGGT
AGTACATCGACTTCCAAGAAGCAATACTCCGACCTGTGGAACTTCGACCCGGATTGGGACTACCGCTTCACGGAT
GTCTTCCCCATGGCCAAGCGTGGAGGCTGCCCTATGATGGCCATGTCCCAGCAGATGGAGGGTGTCGCGGAGAGC
AATCTCATGCGCCTCCAAATGAACGGCACTGATCAGGTCACTCTCTTCGAGACCAAAAAGGGCATGATCAATCCA
TCCATTGCAGAAGGCTTCAACGCCCGTGCCTACCAGGGCAGCTGGGGGCCCAATGATACGAACATCACGTTCGGC
TACGGTGCATACTTTGTCGGTCGTCAAAGTAGCCCCGGTTTCATTTTCAGTGTCACCCCGGAGGGCACGGGCGTG
ACGCTTCTCGCGGGCAACAACATTACCAACTACGGATTCCCGTCCTATAATTATGATGGCACTCAGGTCGTTTTC
CGAACCTGGCCTGGCACTGCCTCCAACGGTACCACTGTTGGTACGACCGGATTAGCCATTGTTGATCTACCCTCC
CGGCAGGTGACGCAGCTCACGACCGAGTGGGATAATCTTCCGGCCTTCTCTCCCGATGGCAAGAAGATTCTGTTC
ACCCGGCGCACAAACCTGGACAATATCGGCGACAACTATGACATTTTCACTATGAATCCCGACGGCAGTGAACTT
ACCAAGCTCACCCCATCTATCGCCAGTGACGCCCATGCTGTGTGGACCCAAGACGGCCGTATCCTTTACAGTACT
GCTATGTTCGGCTTCCAGCAGGAGGCACCCTTATATGATGACTCTATGCAGCCCTATGCTATCATCATGCTCATG
GAAGCCGATGGTAGTAACAAGACTGCGTTGTCCAACAGTTTGTGGGAAGATGCCATGCCTATGTTTGCGCCAGCG
CATGTAATGGAGTCCGACTGTTGTTCTTGA
Gene >Ani_SJS100_1|g8407.t1
ATGCATGTTACGAAGACATGGGCCTGGCTTGCATTAGCCACTGCCACGCTGGTCTCTGGTGCGTCACACTATGAA
GGCCAGGGTCATGCCGCTAGAAGAGCAGCCTCAGACACATATAAGGGGACCTTTCTACACAATCGCATCAGTCCC
AACTACTCCGAGCTGTACATTGCCGAACCAGATGGCTCTAACGCGAAGCTCCTCCTTGGTTCCAACAGCGTGTAC
GATTTCCGAGCAAGCTGGTCTCCTGATGCCAAACATGTTTATTTCACGTCAGAAAGAAGAGGGGACGGCCAGGCG
GACATTTACCGCGTGGCCATAAATGGCACGAGCACGGTGGGAGCAGAAGTCGAACCTGTCGCCTTGTCACCAGGT
GTCGACGACTCTGCTTCAATCTCCCCTGATGGCAAGATGCTGGCGTTTGCAACTTCGAGATACAATCAGACCAGT
CAGATCATGCTGATGGTCCTGGAAACGGGATCTCTCAAGAACCTGACGCTCATTCCTGGTATCTCCGAAGCTGCC
AACTCCGCACTACCCAATGGATACTTCAAGCCGACATGGTCCCCCGATGGAGAGTGGATTGTCTTCACGTCCGAT
CGTAACACACCATGGCGTGGCCACAGCGACGGTTCGGGATGGGAGCATACCCAGGAGTTGTCCATCTACGCAGCC
CGCCCTAATGGCACCGACTTCCGACTGGTGTCGTCTCGGAGCAACTACACCCAAGGCTCGCCTAGGTTCTCGCCG
AATGGAAAGCGCCTGGTCTTCTACGAGATGCTGACCGAGGACACGTACAATGGTCGTCTACAGCCTGAACTGCTT
GAAGGTTCTTATCTTAACACCAGCATCGTCTCAATCGATTTCGCCACTGGAGGTGACCGTATCGTTCATGCCACT
GGAGATGGCACCAAGATTAGCCCTTCATTTGTCACCGATGATGTGAGTACTCAGGTCTAGCCAGCATAGGGCGAT
TTGTTGTTTTTTACTTACCGATGAATGCGTTCACTAGGTTATTGGCTATGTTATGAAAGAGTCAGCCAGCAACGG
TATCTACTACACGTCTCTCTCGGGCAAAAATTACACGCAGTACCAGACCATTCCCATGAACACCATGACACCTGC
ACTACGCTCCCCTGCGTGGTCGCCAGATGGCAAATATGTCATCTATGAGAAGCAGGGTCCCACGGGCGGTAGTAC
ATCGACTTCCAAGAAGCAATACTCCGACCTGTGGAACTTCGACCCGGATTGGGACTACCGCTTCACGGATGTCTT
CCCCATGGCCAAGCGTGGAGGCTGCCCTATGATGGCCATGTCCCAGCAGATGGAGGGTGTCGCGGAGAGCAATCT
CATGCGCCTCCAAATGAACGGCACTGATCAGGTCACTCTCTTCGAGACCAAAAAGGGCATGATCAATCCATCCAT
TGCAGAAGGCTTCAACGCCCGTGCCTACCAGGGCAGCTGGGGGCCCAATGATACGAACATCACGTTCGGCTACGG
TGCATACTTTGTCGGTCGTCAAAGTAGCCCCGGTTTCATTTTCAGTGTCACCCCGGAGGGCACGGGCGTGACGCT
TCTCGCGGGCAACAACATTACCAACTACGGATTCCCGTCCTATAATTATGATGGCACTCAGGTCGTTTTCCGAAC
CTGGCCTGGCACTGCCTCCAACGGTACCACTGTTGGTACGACCGGATTAGCCATTGTTGATCTACCCTCCCGGCA
GGTGACGCAGCTCACGACCGAGTGGGATAATCTTCCGGCCTTCTCTCCCGATGGCAAGAAGATTCTGTTCACCCG
GCGCACAAACCTGGACAATATCGGCGACAACTATGACATTTTCACTATGAATCCCGACGGCAGTGAACTTACCAA
GCTCACCCCATCTATCGCCAGTGACGCCCATGCTGTGTGGACCCAAGACGGCCGTATCCTTTACAGTACTGCTAT
GTTCGGCTTCCAGCAGGAGGCACCCTTATATGATGACTCTATGCAGCCCTATGCTATCATCATGCTCATGGAAGC
CGATGGTAGTAACAAGACTGCGTTGTCCAACAGTTTGTGGGAAGATGCCATGCCTATGTTTGCGCCAGCGCATGT
AATGGAGTCCGACTGTTGTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail