Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g7808.t1
Gene name
Locationscaffold_057:44517..47360
Strand-
Gene length (bp)2843
Transcript length (bp)2718
Coding sequence length (bp)2718
Protein length (aa) 906

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00488 MutS_V MutS domain V 2.7E-72 696 882
PF05192 MutS_III MutS domain III 5.4E-44 285 642
PF01624 MutS_I MutS domain I 4.6E-20 2 107
PF05188 MutS_II MutS domain II 6.9E-06 149 195

GO

GO Term Description Terminal node
GO:0006298 mismatch repair Yes
GO:0030983 mismatched DNA binding Yes
GO:0005524 ATP binding Yes
GO:0033554 cellular response to stress No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003690 double-stranded DNA binding No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0006281 DNA repair No
GO:0097367 carbohydrate derivative binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043167 ion binding No
GO:0090304 nucleic acid metabolic process No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0003676 nucleic acid binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0050896 response to stimulus No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0006259 DNA metabolic process No
GO:0003677 DNA binding No
GO:0006950 response to stress No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g7808.t1
MQKFKNCVILTRVGGFYELYFEQAEEFAPLLNLKLASKKTSAGPVPMAGFPFFQLDRFLKILVQDLNKYVAVSEE
FPNAAEDKLRPGGLLFDRKVARIITPGTLIDEKFMDPSENNFLLAVYIDKSSLKEQLMQQDASSSQQHVLLSASQ
NVGLSWLDLSTGDFFTQVTTAQMLPSAIARIGAREILVDQGLQDVIGQELQLLIGHDQRLMTFFQFPKKVAPMAR
WEAMLEAPVSDAAAETFTREEVAAGYSLLEYIRVQLQGLNMKLQPPRRRHLDESMSIDRNSLRGLEILETARDGF
GKGSLLHAVRRTSTKSGARLLRDRLTSPSTSLSVINERLDLVSIFIEDRDLHDNVIQFLKRSYDAQRLVQKFTLG
RGDPDDLICLSRAIEASKEIRQVLSRKWHSEADSQTKRSIGIMVDRIHMDGPTVLADKILTAIDEEGLLQKQRIE
DDTAAEAALLAQSVTLNEGIPEDMAALPKKVKTKSSDRSSASTDEGTIADTWIMRRDASPALSELHQDLEQLHTA
KSELTQRLRESVGSSALTLKWTPGLGHICHVKGARITQESLEELGVTRNVSSTKSTRSFYLPAWTELGGQMDQVK
TQIRQEEQVIFEHLRREVILNLVKIRRNAAVMDELDVACSFATLAQEQQLVRPILNEDKSHKIVGGRHPTVKLGL
EEQGRRFVSNDCFLGGPERIWLVTGPNMAGKSTFLRQNALITILAQVGSFVPAAYAEIGLVDQIFSRIGAADDLF
RDQSTFMVEMLETAAILKQATSRSFVIMDEVGRGTTPEDGTAVSFACLHHLHYHNKCRTLFATHFHVLADMTHDF
DALGRYCTDVKESASGSFSFIHRLRKGVNRESHALKVAQLAGLPREAIEMAKNVRQRFANHNDSPHWDENSAPKH
TANGA*
Coding >Ani_SJS100_1|g7808.t1
ATGCAGAAGTTCAAAAACTGCGTGATCTTGACTAGAGTAGGCGGCTTTTACGAGCTCTATTTTGAGCAAGCTGAA
GAATTCGCTCCGTTGCTCAACCTTAAGCTTGCCTCCAAGAAAACCAGTGCGGGCCCTGTCCCTATGGCTGGTTTT
CCTTTCTTCCAGCTAGACCGTTTTCTTAAGATCCTTGTTCAGGACCTGAACAAGTACGTGGCTGTCAGCGAAGAA
TTCCCAAATGCCGCAGAAGACAAGCTCCGACCCGGGGGTCTTCTCTTCGATCGTAAAGTGGCCAGAATCATCACA
CCTGGCACATTAATCGATGAGAAGTTCATGGATCCCTCCGAGAATAATTTCTTATTGGCCGTCTACATTGATAAA
TCTTCGTTGAAGGAGCAGTTAATGCAACAGGATGCCTCATCCTCGCAACAGCACGTTCTTTTATCCGCGTCCCAG
AATGTAGGCTTGTCCTGGTTGGACCTGTCCACAGGCGACTTCTTCACGCAAGTAACTACAGCACAGATGCTGCCG
TCTGCTATCGCCAGGATTGGCGCCCGGGAGATACTTGTAGACCAAGGTCTTCAGGATGTAATCGGGCAGGAGCTG
CAGTTATTGATTGGACACGATCAACGATTAATGACTTTCTTCCAATTTCCGAAAAAAGTTGCGCCCATGGCCCGA
TGGGAAGCTATGCTTGAAGCCCCTGTGTCAGACGCCGCCGCAGAAACCTTTACGCGTGAAGAGGTCGCCGCCGGG
TATAGTCTCTTGGAGTACATCCGGGTACAGCTGCAAGGCTTGAATATGAAGCTTCAGCCTCCTCGTCGCCGACAT
TTAGACGAGTCGATGAGTATCGACCGAAATAGTTTAAGAGGTCTAGAAATATTGGAAACTGCCCGTGATGGCTTT
GGGAAAGGAAGCCTTCTTCATGCCGTGCGGCGAACTTCTACCAAGAGTGGAGCACGTTTGCTGAGAGACCGTCTT
ACATCGCCTTCCACCTCTTTATCGGTAATCAACGAACGGCTTGACCTTGTTTCCATATTCATCGAAGACCGCGAT
CTGCATGACAATGTCATCCAGTTTCTAAAACGCAGCTATGATGCCCAACGTCTAGTACAGAAATTTACACTTGGT
CGGGGTGACCCTGATGATCTAATCTGCCTTTCGAGGGCAATTGAAGCCTCCAAGGAAATCCGACAGGTTTTATCA
CGAAAGTGGCATAGCGAGGCTGACAGTCAAACCAAGCGCAGCATTGGAATTATGGTCGACCGAATCCACATGGAT
GGGCCTACAGTCTTAGCTGACAAAATACTGACAGCAATTGACGAGGAAGGACTGCTGCAGAAGCAACGCATTGAG
GACGACACAGCTGCAGAGGCAGCACTTCTAGCACAGTCTGTCACTCTGAATGAGGGTATCCCAGAGGACATGGCC
GCACTACCAAAAAAAGTCAAGACGAAAAGCAGTGATCGGTCTAGCGCATCTACGGATGAGGGGACGATTGCCGAT
ACCTGGATCATGAGGCGAGATGCAAGCCCGGCTCTAAGTGAACTCCATCAGGATCTAGAGCAATTACATACTGCA
AAATCGGAGCTAACACAGCGTCTTCGCGAGTCGGTGGGCTCATCTGCGTTAACACTCAAGTGGACTCCGGGATTG
GGTCACATATGCCATGTCAAGGGGGCTAGGATTACCCAAGAATCATTGGAAGAACTTGGAGTAACACGGAATGTC
TCGTCCACTAAGTCAACGAGGTCGTTCTACCTACCTGCTTGGACGGAACTAGGCGGCCAGATGGACCAAGTGAAA
ACTCAAATCCGTCAAGAAGAACAAGTTATCTTTGAGCATTTGCGTAGGGAGGTTATCCTTAACCTTGTCAAGATT
CGACGCAATGCGGCCGTTATGGATGAACTAGATGTCGCGTGCTCGTTTGCCACTTTGGCTCAGGAACAGCAACTA
GTGCGCCCAATCCTCAACGAAGATAAAAGCCACAAGATTGTAGGCGGACGCCATCCCACAGTCAAGCTTGGGCTC
GAGGAACAAGGGCGACGGTTTGTCAGCAACGATTGCTTTCTCGGAGGCCCAGAGCGTATCTGGCTTGTGACCGGA
CCCAATATGGCAGGTAAAAGCACTTTTCTGCGACAGAACGCACTGATCACAATCCTGGCCCAGGTCGGCTCATTT
GTCCCTGCAGCGTATGCAGAGATTGGCTTGGTTGACCAGATCTTCAGTCGCATTGGGGCCGCTGATGATCTGTTC
CGAGACCAGTCCACATTCATGGTCGAGATGTTGGAAACAGCAGCTATTCTCAAACAAGCGACCTCACGCTCGTTT
GTCATCATGGATGAGGTCGGGCGTGGGACCACGCCAGAAGACGGAACTGCCGTTAGTTTTGCATGCTTGCATCAC
TTGCATTACCACAACAAATGCCGGACACTGTTTGCGACTCACTTCCATGTCCTTGCCGATATGACCCACGACTTT
GACGCTCTCGGCAGATACTGCACCGATGTCAAAGAATCCGCCTCTGGATCATTCTCATTTATTCATCGACTACGG
AAAGGTGTGAACCGCGAGTCGCATGCTTTGAAAGTCGCCCAGTTGGCTGGACTACCCAGGGAGGCCATTGAAATG
GCAAAGAACGTGCGTCAGCGATTCGCCAACCACAACGACAGCCCACATTGGGATGAAAATTCGGCACCAAAACAT
ACAGCGAATGGAGCGTGA
Transcript >Ani_SJS100_1|g7808.t1
ATGCAGAAGTTCAAAAACTGCGTGATCTTGACTAGAGTAGGCGGCTTTTACGAGCTCTATTTTGAGCAAGCTGAA
GAATTCGCTCCGTTGCTCAACCTTAAGCTTGCCTCCAAGAAAACCAGTGCGGGCCCTGTCCCTATGGCTGGTTTT
CCTTTCTTCCAGCTAGACCGTTTTCTTAAGATCCTTGTTCAGGACCTGAACAAGTACGTGGCTGTCAGCGAAGAA
TTCCCAAATGCCGCAGAAGACAAGCTCCGACCCGGGGGTCTTCTCTTCGATCGTAAAGTGGCCAGAATCATCACA
CCTGGCACATTAATCGATGAGAAGTTCATGGATCCCTCCGAGAATAATTTCTTATTGGCCGTCTACATTGATAAA
TCTTCGTTGAAGGAGCAGTTAATGCAACAGGATGCCTCATCCTCGCAACAGCACGTTCTTTTATCCGCGTCCCAG
AATGTAGGCTTGTCCTGGTTGGACCTGTCCACAGGCGACTTCTTCACGCAAGTAACTACAGCACAGATGCTGCCG
TCTGCTATCGCCAGGATTGGCGCCCGGGAGATACTTGTAGACCAAGGTCTTCAGGATGTAATCGGGCAGGAGCTG
CAGTTATTGATTGGACACGATCAACGATTAATGACTTTCTTCCAATTTCCGAAAAAAGTTGCGCCCATGGCCCGA
TGGGAAGCTATGCTTGAAGCCCCTGTGTCAGACGCCGCCGCAGAAACCTTTACGCGTGAAGAGGTCGCCGCCGGG
TATAGTCTCTTGGAGTACATCCGGGTACAGCTGCAAGGCTTGAATATGAAGCTTCAGCCTCCTCGTCGCCGACAT
TTAGACGAGTCGATGAGTATCGACCGAAATAGTTTAAGAGGTCTAGAAATATTGGAAACTGCCCGTGATGGCTTT
GGGAAAGGAAGCCTTCTTCATGCCGTGCGGCGAACTTCTACCAAGAGTGGAGCACGTTTGCTGAGAGACCGTCTT
ACATCGCCTTCCACCTCTTTATCGGTAATCAACGAACGGCTTGACCTTGTTTCCATATTCATCGAAGACCGCGAT
CTGCATGACAATGTCATCCAGTTTCTAAAACGCAGCTATGATGCCCAACGTCTAGTACAGAAATTTACACTTGGT
CGGGGTGACCCTGATGATCTAATCTGCCTTTCGAGGGCAATTGAAGCCTCCAAGGAAATCCGACAGGTTTTATCA
CGAAAGTGGCATAGCGAGGCTGACAGTCAAACCAAGCGCAGCATTGGAATTATGGTCGACCGAATCCACATGGAT
GGGCCTACAGTCTTAGCTGACAAAATACTGACAGCAATTGACGAGGAAGGACTGCTGCAGAAGCAACGCATTGAG
GACGACACAGCTGCAGAGGCAGCACTTCTAGCACAGTCTGTCACTCTGAATGAGGGTATCCCAGAGGACATGGCC
GCACTACCAAAAAAAGTCAAGACGAAAAGCAGTGATCGGTCTAGCGCATCTACGGATGAGGGGACGATTGCCGAT
ACCTGGATCATGAGGCGAGATGCAAGCCCGGCTCTAAGTGAACTCCATCAGGATCTAGAGCAATTACATACTGCA
AAATCGGAGCTAACACAGCGTCTTCGCGAGTCGGTGGGCTCATCTGCGTTAACACTCAAGTGGACTCCGGGATTG
GGTCACATATGCCATGTCAAGGGGGCTAGGATTACCCAAGAATCATTGGAAGAACTTGGAGTAACACGGAATGTC
TCGTCCACTAAGTCAACGAGGTCGTTCTACCTACCTGCTTGGACGGAACTAGGCGGCCAGATGGACCAAGTGAAA
ACTCAAATCCGTCAAGAAGAACAAGTTATCTTTGAGCATTTGCGTAGGGAGGTTATCCTTAACCTTGTCAAGATT
CGACGCAATGCGGCCGTTATGGATGAACTAGATGTCGCGTGCTCGTTTGCCACTTTGGCTCAGGAACAGCAACTA
GTGCGCCCAATCCTCAACGAAGATAAAAGCCACAAGATTGTAGGCGGACGCCATCCCACAGTCAAGCTTGGGCTC
GAGGAACAAGGGCGACGGTTTGTCAGCAACGATTGCTTTCTCGGAGGCCCAGAGCGTATCTGGCTTGTGACCGGA
CCCAATATGGCAGGTAAAAGCACTTTTCTGCGACAGAACGCACTGATCACAATCCTGGCCCAGGTCGGCTCATTT
GTCCCTGCAGCGTATGCAGAGATTGGCTTGGTTGACCAGATCTTCAGTCGCATTGGGGCCGCTGATGATCTGTTC
CGAGACCAGTCCACATTCATGGTCGAGATGTTGGAAACAGCAGCTATTCTCAAACAAGCGACCTCACGCTCGTTT
GTCATCATGGATGAGGTCGGGCGTGGGACCACGCCAGAAGACGGAACTGCCGTTAGTTTTGCATGCTTGCATCAC
TTGCATTACCACAACAAATGCCGGACACTGTTTGCGACTCACTTCCATGTCCTTGCCGATATGACCCACGACTTT
GACGCTCTCGGCAGATACTGCACCGATGTCAAAGAATCCGCCTCTGGATCATTCTCATTTATTCATCGACTACGG
AAAGGTGTGAACCGCGAGTCGCATGCTTTGAAAGTCGCCCAGTTGGCTGGACTACCCAGGGAGGCCATTGAAATG
GCAAAGAACGTGCGTCAGCGATTCGCCAACCACAACGACAGCCCACATTGGGATGAAAATTCGGCACCAAAACAT
ACAGCGAATGGAGCGTGA
Gene >Ani_SJS100_1|g7808.t1
ATGCAGAAGTTCAAAAACTGCGTGATCTTGACTAGAGTAGGCGGCTTTTACGAGGTATGACTACCGGCTTTATGC
TACTTCTACATCTATAAAGTCTAGGTCTTCCAGAGGGTACTCCTAACTAGTCTTAGCTCTATTTTGAGCAAGCTG
AAGAATTCGCTCCGTTGCTCAACCTTAAGCTTGCCTCCAAGAAAACCAGTGCGGGCCCTGTCCCTATGGCTGGTT
TTCCTTTCTTCCAGCTAGACCGTTTTCTTAAGATCCTTGTTCAGGACCTGAACAAGTACGTGGCTGTCAGCGAAG
AATTCCCAAATGCCGCAGAAGACAAGCTCCGACCCGGGGGTCTTCTCTTCGATCGTAAAGTGGCCAGAATCATCA
CACCTGGCACATTAATCGATGAGAAGTTCATGGATCCCTCCGAGAATAATTTCTTATTGGCCGTCTACATTGATA
AATCTTCGTTGAAGGAGCAGTTAATGCAACAGGATGCCTCATCCTCGCAACAGCACGTTCTTTTATCCGCGTCCC
AGAATGTAGGCTTGTCCTGGTTGGACCTGTCCACAGGCGACTTCTTCACGCAAGTAACTACAGCACAGATGCTGC
CGTCTGCTATCGCCAGGATTGGCGCCCGGGAGATACTTGTAGACCAAGGTCTTCAGGATGTAATCGGGCAGGAGC
TGCAGTTATTGATTGGACACGATCAACGATTAATGACTTTCTTCCAATTTCCGAAAAAAGTTGCGCCCATGGCCC
GATGGGAAGCTATGCTTGAAGCCCCTGTGTCAGACGCCGCCGCAGAAACCTTTACGCGTGAAGAGGTCGCCGCCG
GGTATAGTCTCTTGGAGTACATCCGGGTACAGCTGCAAGGCTTGAATATGAAGCTTCAGCCTCCTCGTCGCCGAC
ATTTAGACGAGTCGATGAGTATCGACCGAAATAGTTTAAGAGGTCTAGAAATATTGGAAACTGCCCGTGATGGCT
TTGGGAAAGGAAGCCTTCTTCATGCCGTGCGGCGAACTTCTACCAAGAGTGGAGCACGTTTGCTGAGAGACCGTC
TTAGTATGCCTAATAACCTCCCTTGGTTTCTATAATCTAACATTGTGGCAGCATCGCCTTCCACCTCTTTATCGG
TAATCAACGAACGGCTTGACCTTGTTTCCATATTCATCGAAGACCGCGATCTGCATGACAATGTCATCCAGTTTC
TAAAACGCAGCTATGATGCCCAACGTCTAGTACAGAAATTTACACTTGGTCGGGGTGACCCTGATGATCTAATCT
GCCTTTCGAGGGCAATTGAAGCCTCCAAGGAAATCCGACAGGTTTTATCACGAAAGTGGCATAGCGAGGCTGACA
GTCAAACCAAGCGCAGCATTGGAATTATGGTCGACCGAATCCACATGGATGGGCCTACAGTCTTAGCTGACAAAA
TACTGACAGCAATTGACGAGGAAGGACTGCTGCAGAAGCAACGCATTGAGGACGACACAGCTGCAGAGGCAGCAC
TTCTAGCACAGTCTGTCACTCTGAATGAGGGTATCCCAGAGGACATGGCCGCACTACCAAAAAAAGTCAAGACGA
AAAGCAGTGATCGGTCTAGCGCATCTACGGATGAGGGGACGATTGCCGATACCTGGATCATGAGGCGAGATGCAA
GCCCGGCTCTAAGTGAACTCCATCAGGATCTAGAGCAATTACATACTGCAAAATCGGAGCTAACACAGCGTCTTC
GCGAGTCGGTGGGCTCATCTGCGTTAACACTCAAGTGGACTCCGGGATTGGGTCACATATGCCATGTCAAGGGGG
CTAGGATTACCCAAGAATCATTGGAAGAACTTGGAGTAACACGGAATGTCTCGTCCACTAAGTCAACGAGGTCGT
TCTACCTACCTGCTTGGACGGAACTAGGCGGCCAGATGGACCAAGTGAAAACTCAAATCCGTCAAGAAGAACAAG
TTATCTTTGAGCATTTGCGTAGGGAGGTTATCCTTAACCTTGTCAAGATTCGACGCAATGCGGCCGTTATGGATG
AACTAGATGTCGCGTGCTCGTTTGCCACTTTGGCTCAGGAACAGCAACTAGTGCGCCCAATCCTCAACGAAGATA
AAAGCCACAAGATTGTAGGCGGACGCCATCCCACAGTCAAGCTTGGGCTCGAGGAACAAGGGCGACGGTTTGTCA
GCAACGATTGCTTTCTCGGAGGCCCAGAGCGTATCTGGCTTGTGACCGGACCCAATATGGCAGGTAAAAGCACTT
TTCTGCGACAGAACGCACTGATCACAATCCTGGCCCAGGTCGGCTCATTTGTCCCTGCAGCGTATGCAGAGATTG
GCTTGGTTGACCAGATCTTCAGTCGCATTGGGGCCGCTGATGATCTGTTCCGAGACCAGTCCACATTCATGGTCG
AGATGTTGGAAACAGCAGCTATTCTCAAACAAGCGACCTCACGCTCGTTTGTCATCATGGATGAGGTCGGGCGTG
GGACCACGCCAGAAGACGGAACTGCCGTTAGTTTTGCATGCTTGCATCACTTGCATTACCACAACAAATGCCGGA
CACTGTTTGCGACTCACTTCCATGTCCTTGCCGATATGACCCACGACTTTGACGCTCTCGGCAGATACTGCACCG
ATGTCAAAGAATCCGCCTCTGGATCATTCTCATTTATTCATCGACTACGGAAAGGTGTGAACCGCGAGTCGCATG
CTTTGAAAGTCGCCCAGTTGGCTGGACTACCCAGGGAGGCCATTGAAATGGCAAAGAACGTGCGTCAGCGATTCG
CCAACCACAACGACAGCCCACATTGGGATGAAAATTCGGCACCAAAACATACAGCGAATGGAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail