Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g7733.t1
Gene name
Locationscaffold_056:36990..39464
Strand+
Gene length (bp)2474
Transcript length (bp)2370
Coding sequence length (bp)2370
Protein length (aa) 790

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 2.0E-05 68 195

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 103 125 22
3 137 156 19
4 176 198 22
5 203 225 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g7733.t1
MTADSGLSAAGSSTYASNTLHVGDGTWDSERDTYLLPNLMGINFDTMRYNGMGNRFKDMPEYHTLIVVHGVIATI
VFLFLVPISVLIIRYYSRWNPFWAFKLHVWCQVLTLLLSTVVFVFGWFAVGPKRSLTNPHHGIGLAIYVLVIFQI
LWGWLVHKIERNRRSYHVPLKLVIHRWIGRALAILGLVQIPLGLTLYGSPKVLFILYAVVAFILLAVFFVLSYLY
DTEGYHMESGGYESRLSYVSGPSAADDHGHSNLGPMAAAGATGAGLASLFRRRSRGRPHDYDESHTSFSDEKLSD
EGPRRGGKGNLLLKLGAIGGGAWLAKKFFDRRRERDNDTESGRYSRAHTRSDSMTEESLSRLEDGRRPEPTAHTP
LNRPPSRPPSRPPSRPPSRPPSRPLSRPQSPGSSYLYNSTYLSEAPPRRPSHGLRDALLGAGAFAAIKGFFSRRK
GDAEQRRVEEMRRREMEDERLARANSKRRYPGEGYYPRRDRPASFTATDLSTDLSRPPRGPPHGESIVSAAGPPM
ASGAVDGARSDIPPAPGPPVPPPAASEYPGPAASTHGPTELASGVAAGTALGAASSAHRRRSASRHRSSSRPRSS
SRHRDPIASPPVSVKLKMHNDGRHVTLRRLTDEEAAASREARRRERRNSRRRAGSASSLSGNEGGSYDRWRRVEE
LERQQQEQMQREQAAAAAASSGFPATSAAPSSSMPPATSAYYAPPPQNGNGSHMPPPPPPPVPSSHPYGTGSIAS
PGTFTGTEASGDYASNRRRRRAERARARQERQQHGVEFT*
Coding >Ani_SJS100_1|g7733.t1
ATGACGGCCGACTCTGGCCTCTCCGCTGCGGGGAGCAGTACCTACGCTTCAAATACACTGCATGTCGGCGATGGA
ACGTGGGACTCGGAGCGCGACACATATCTCCTCCCTAATCTGATGGGTATCAACTTCGACACAATGCGATACAAT
GGAATGGGAAATCGATTCAAAGATATGCCCGAATACCATACCCTCATAGTCGTTCACGGCGTCATCGCTACAATC
GTCTTCCTTTTTCTCGTCCCAATCTCTGTCTTGATCATCCGATACTACTCTCGATGGAATCCTTTCTGGGCCTTC
AAGCTGCATGTCTGGTGCCAGGTCCTGACATTGTTGCTGAGCACCGTCGTGTTCGTGTTCGGTTGGTTCGCTGTC
GGTCCAAAGAGAAGCCTGACAAACCCGCATCACGGTATCGGACTTGCGATATATGTCCTAGTGATCTTTCAGATT
CTGTGGGGCTGGCTTGTTCATAAGATTGAGAGGAACAGGAGGAGTTACCATGTTCCCTTGAAGCTTGTGATTCAT
CGATGGATTGGACGCGCCCTCGCCATCCTAGGTCTTGTTCAGATACCATTGGGGCTCACCCTTTATGGCTCGCCT
AAAGTGCTATTTATCCTCTACGCTGTTGTCGCCTTCATCCTCCTCGCAGTGTTCTTTGTGCTGTCATATCTATAC
GACACAGAAGGATATCACATGGAGAGCGGCGGATACGAAAGCCGACTCAGCTATGTCTCAGGACCCTCAGCTGCC
GATGATCATGGTCATAGTAACCTCGGACCCATGGCTGCCGCAGGAGCGACCGGAGCTGGCCTGGCTTCGCTCTTC
AGACGTCGTTCCAGAGGCAGACCACACGATTATGACGAATCGCATACCAGTTTCTCAGATGAAAAGCTTTCTGAT
GAAGGACCACGGCGTGGTGGCAAAGGGAACTTACTTCTGAAATTAGGTGCAATTGGCGGTGGTGCCTGGCTCGCG
AAGAAATTCTTTGACAGAAGACGCGAACGAGACAACGACACGGAGTCCGGTCGATACAGTAGAGCTCATACTCGG
AGCGACAGCATGACCGAAGAAAGCTTGAGTAGACTGGAAGATGGGCGGCGACCCGAGCCAACAGCGCATACTCCT
CTCAACCGTCCACCAAGCAGACCTCCAAGCAGACCTCCCAGCAGACCTCCCAGCAGACCACCAAGTCGACCTCTA
AGCCGTCCTCAAAGCCCAGGCTCTTCGTACCTGTACAACAGCACCTATCTTTCCGAAGCTCCCCCTCGCAGGCCA
TCCCACGGACTTCGAGACGCTCTTCTCGGAGCGGGAGCATTTGCAGCGATCAAGGGCTTCTTCTCGCGTCGCAAG
GGCGACGCAGAACAACGTCGCGTGGAAGAGATGCGCCGTCGGGAGATGGAAGACGAGCGGCTAGCCCGGGCCAAC
AGCAAGCGGCGCTACCCCGGAGAGGGCTATTACCCAAGACGTGACCGACCGGCATCATTCACAGCCACGGACCTT
TCAACAGACCTGTCCCGGCCACCCCGCGGTCCGCCGCACGGCGAGTCCATAGTCTCAGCAGCGGGACCCCCAATG
GCATCCGGAGCAGTGGACGGTGCACGCTCAGACATACCGCCTGCACCAGGGCCACCCGTTCCCCCACCAGCAGCA
TCGGAATACCCAGGACCAGCAGCATCTACACACGGTCCTACAGAGCTCGCCTCCGGAGTAGCAGCCGGAACAGCC
CTAGGTGCTGCGTCATCGGCACATCGCCGTCGCAGCGCCAGCCGTCACCGAAGCAGCAGCCGGCCCAGGAGTAGC
AGCCGTCACCGCGATCCCATCGCATCTCCCCCCGTTTCTGTCAAACTGAAAATGCACAACGACGGCCGCCACGTT
ACTCTCCGGAGACTAACGGATGAAGAAGCTGCCGCCAGTCGCGAAGCGAGACGAAGAGAGCGAAGGAATTCCCGT
CGTCGCGCCGGCAGTGCAAGCTCGCTATCAGGAAACGAAGGGGGCTCGTATGACCGCTGGCGCCGTGTTGAGGAG
CTGGAGCGCCAGCAACAGGAACAGATGCAACGAGAACAGGCTGCGGCGGCGGCGGCTTCCTCGGGCTTCCCAGCG
ACTTCTGCTGCTCCATCATCAAGTATGCCTCCCGCCACGTCCGCCTACTATGCACCACCTCCTCAGAACGGAAAC
GGGAGTCATATGCCGCCGCCCCCGCCGCCCCCGGTGCCATCTAGCCATCCTTATGGGACAGGGAGTATCGCGTCT
CCGGGTACATTTACTGGGACGGAAGCGAGCGGGGACTATGCGAGCAATCGTCGACGAAGACGAGCGGAGAGAGCT
CGAGCACGTCAGGAAAGACAACAGCATGGTGTGGAATTTACTTGA
Transcript >Ani_SJS100_1|g7733.t1
ATGACGGCCGACTCTGGCCTCTCCGCTGCGGGGAGCAGTACCTACGCTTCAAATACACTGCATGTCGGCGATGGA
ACGTGGGACTCGGAGCGCGACACATATCTCCTCCCTAATCTGATGGGTATCAACTTCGACACAATGCGATACAAT
GGAATGGGAAATCGATTCAAAGATATGCCCGAATACCATACCCTCATAGTCGTTCACGGCGTCATCGCTACAATC
GTCTTCCTTTTTCTCGTCCCAATCTCTGTCTTGATCATCCGATACTACTCTCGATGGAATCCTTTCTGGGCCTTC
AAGCTGCATGTCTGGTGCCAGGTCCTGACATTGTTGCTGAGCACCGTCGTGTTCGTGTTCGGTTGGTTCGCTGTC
GGTCCAAAGAGAAGCCTGACAAACCCGCATCACGGTATCGGACTTGCGATATATGTCCTAGTGATCTTTCAGATT
CTGTGGGGCTGGCTTGTTCATAAGATTGAGAGGAACAGGAGGAGTTACCATGTTCCCTTGAAGCTTGTGATTCAT
CGATGGATTGGACGCGCCCTCGCCATCCTAGGTCTTGTTCAGATACCATTGGGGCTCACCCTTTATGGCTCGCCT
AAAGTGCTATTTATCCTCTACGCTGTTGTCGCCTTCATCCTCCTCGCAGTGTTCTTTGTGCTGTCATATCTATAC
GACACAGAAGGATATCACATGGAGAGCGGCGGATACGAAAGCCGACTCAGCTATGTCTCAGGACCCTCAGCTGCC
GATGATCATGGTCATAGTAACCTCGGACCCATGGCTGCCGCAGGAGCGACCGGAGCTGGCCTGGCTTCGCTCTTC
AGACGTCGTTCCAGAGGCAGACCACACGATTATGACGAATCGCATACCAGTTTCTCAGATGAAAAGCTTTCTGAT
GAAGGACCACGGCGTGGTGGCAAAGGGAACTTACTTCTGAAATTAGGTGCAATTGGCGGTGGTGCCTGGCTCGCG
AAGAAATTCTTTGACAGAAGACGCGAACGAGACAACGACACGGAGTCCGGTCGATACAGTAGAGCTCATACTCGG
AGCGACAGCATGACCGAAGAAAGCTTGAGTAGACTGGAAGATGGGCGGCGACCCGAGCCAACAGCGCATACTCCT
CTCAACCGTCCACCAAGCAGACCTCCAAGCAGACCTCCCAGCAGACCTCCCAGCAGACCACCAAGTCGACCTCTA
AGCCGTCCTCAAAGCCCAGGCTCTTCGTACCTGTACAACAGCACCTATCTTTCCGAAGCTCCCCCTCGCAGGCCA
TCCCACGGACTTCGAGACGCTCTTCTCGGAGCGGGAGCATTTGCAGCGATCAAGGGCTTCTTCTCGCGTCGCAAG
GGCGACGCAGAACAACGTCGCGTGGAAGAGATGCGCCGTCGGGAGATGGAAGACGAGCGGCTAGCCCGGGCCAAC
AGCAAGCGGCGCTACCCCGGAGAGGGCTATTACCCAAGACGTGACCGACCGGCATCATTCACAGCCACGGACCTT
TCAACAGACCTGTCCCGGCCACCCCGCGGTCCGCCGCACGGCGAGTCCATAGTCTCAGCAGCGGGACCCCCAATG
GCATCCGGAGCAGTGGACGGTGCACGCTCAGACATACCGCCTGCACCAGGGCCACCCGTTCCCCCACCAGCAGCA
TCGGAATACCCAGGACCAGCAGCATCTACACACGGTCCTACAGAGCTCGCCTCCGGAGTAGCAGCCGGAACAGCC
CTAGGTGCTGCGTCATCGGCACATCGCCGTCGCAGCGCCAGCCGTCACCGAAGCAGCAGCCGGCCCAGGAGTAGC
AGCCGTCACCGCGATCCCATCGCATCTCCCCCCGTTTCTGTCAAACTGAAAATGCACAACGACGGCCGCCACGTT
ACTCTCCGGAGACTAACGGATGAAGAAGCTGCCGCCAGTCGCGAAGCGAGACGAAGAGAGCGAAGGAATTCCCGT
CGTCGCGCCGGCAGTGCAAGCTCGCTATCAGGAAACGAAGGGGGCTCGTATGACCGCTGGCGCCGTGTTGAGGAG
CTGGAGCGCCAGCAACAGGAACAGATGCAACGAGAACAGGCTGCGGCGGCGGCGGCTTCCTCGGGCTTCCCAGCG
ACTTCTGCTGCTCCATCATCAAGTATGCCTCCCGCCACGTCCGCCTACTATGCACCACCTCCTCAGAACGGAAAC
GGGAGTCATATGCCGCCGCCCCCGCCGCCCCCGGTGCCATCTAGCCATCCTTATGGGACAGGGAGTATCGCGTCT
CCGGGTACATTTACTGGGACGGAAGCGAGCGGGGACTATGCGAGCAATCGTCGACGAAGACGAGCGGAGAGAGCT
CGAGCACGTCAGGAAAGACAACAGCATGGTGTGGAATTTACTTGA
Gene >Ani_SJS100_1|g7733.t1
ATGACGGCCGACTCTGGCCTCTCCGCTGCGGGGAGCAGTACCTACGCTTCAAATACACTGCATGTCGGCGATGGA
ACGTGGGACTCGGAGCGCGACACATATCTCCTCCCTAATCTGATGGGTATCAACTTCGACACAATGCGATACAAT
GGTTAGTAAGGTTATAGCTCTATGAGGCGCAAATACGCTTACATATGTTAGGAATGGGAAATCGATTCAAAGATA
TGCCCGAATACCATACCCTCATAGTCGTTCACGGCGTCATCGCTACAATCGTCTTCCTTTTTCTCGTCCCAATCT
CTGTCTTGATCATCCGATACTACTCTCGATGGAATCCTTTCTGGGCCTTCAAGCTGCATGTCTGGTGCCAGGTCC
TGACATTGTTGCTGAGCACCGTCGTGTTCGTGTTCGGTTGGTTCGCTGTCGGTCCAAAGAGAAGCCTGACAAACC
CGCATCACGGTATCGGACTTGCGATATATGTCCTAGTGATCTTTCAGATTCTGTGGGGCTGGCTTGTTCATAAGA
TTGAGAGGAACAGGAGGAGTTACCATGTTCCCTTGAAGCTTGTGGTATGTTGCGTGGCCGTTCGATGTTCCGCCC
TAAGGCTAACTTCTACATCACAGATTCATCGATGGATTGGACGCGCCCTCGCCATCCTAGGTCTTGTTCAGATAC
CATTGGGGCTCACCCTTTATGGCTCGCCTAAAGTGCTATTTATCCTCTACGCTGTTGTCGCCTTCATCCTCCTCG
CAGTGTTCTTTGTGCTGTCATATCTATACGACACAGAAGGATATCACATGGAGAGCGGCGGATACGAAAGCCGAC
TCAGCTATGTCTCAGGACCCTCAGCTGCCGATGATCATGGTCATAGTAACCTCGGACCCATGGCTGCCGCAGGAG
CGACCGGAGCTGGCCTGGCTTCGCTCTTCAGACGTCGTTCCAGAGGCAGACCACACGATTATGACGAATCGCATA
CCAGTTTCTCAGATGAAAAGCTTTCTGATGAAGGACCACGGCGTGGTGGCAAAGGGAACTTACTTCTGAAATTAG
GTGCAATTGGCGGTGGTGCCTGGCTCGCGAAGAAATTCTTTGACAGAAGACGCGAACGAGACAACGACACGGAGT
CCGGTCGATACAGTAGAGCTCATACTCGGAGCGACAGCATGACCGAAGAAAGCTTGAGTAGACTGGAAGATGGGC
GGCGACCCGAGCCAACAGCGCATACTCCTCTCAACCGTCCACCAAGCAGACCTCCAAGCAGACCTCCCAGCAGAC
CTCCCAGCAGACCACCAAGTCGACCTCTAAGCCGTCCTCAAAGCCCAGGCTCTTCGTACCTGTACAACAGCACCT
ATCTTTCCGAAGCTCCCCCTCGCAGGCCATCCCACGGACTTCGAGACGCTCTTCTCGGAGCGGGAGCATTTGCAG
CGATCAAGGGCTTCTTCTCGCGTCGCAAGGGCGACGCAGAACAACGTCGCGTGGAAGAGATGCGCCGTCGGGAGA
TGGAAGACGAGCGGCTAGCCCGGGCCAACAGCAAGCGGCGCTACCCCGGAGAGGGCTATTACCCAAGACGTGACC
GACCGGCATCATTCACAGCCACGGACCTTTCAACAGACCTGTCCCGGCCACCCCGCGGTCCGCCGCACGGCGAGT
CCATAGTCTCAGCAGCGGGACCCCCAATGGCATCCGGAGCAGTGGACGGTGCACGCTCAGACATACCGCCTGCAC
CAGGGCCACCCGTTCCCCCACCAGCAGCATCGGAATACCCAGGACCAGCAGCATCTACACACGGTCCTACAGAGC
TCGCCTCCGGAGTAGCAGCCGGAACAGCCCTAGGTGCTGCGTCATCGGCACATCGCCGTCGCAGCGCCAGCCGTC
ACCGAAGCAGCAGCCGGCCCAGGAGTAGCAGCCGTCACCGCGATCCCATCGCATCTCCCCCCGTTTCTGTCAAAC
TGAAAATGCACAACGACGGCCGCCACGTTACTCTCCGGAGACTAACGGATGAAGAAGCTGCCGCCAGTCGCGAAG
CGAGACGAAGAGAGCGAAGGAATTCCCGTCGTCGCGCCGGCAGTGCAAGCTCGCTATCAGGAAACGAAGGGGGCT
CGTATGACCGCTGGCGCCGTGTTGAGGAGCTGGAGCGCCAGCAACAGGAACAGATGCAACGAGAACAGGCTGCGG
CGGCGGCGGCTTCCTCGGGCTTCCCAGCGACTTCTGCTGCTCCATCATCAAGTATGCCTCCCGCCACGTCCGCCT
ACTATGCACCACCTCCTCAGAACGGAAACGGGAGTCATATGCCGCCGCCCCCGCCGCCCCCGGTGCCATCTAGCC
ATCCTTATGGGACAGGGAGTATCGCGTCTCCGGGTACATTTACTGGGACGGAAGCGAGCGGGGACTATGCGAGCA
ATCGTCGACGAAGACGAGCGGAGAGAGCTCGAGCACGTCAGGAAAGACAACAGCATGGTGTGGAATTTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail