Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g7630.t1
Gene name
Locationscaffold_054:197496..199720
Strand-
Gene length (bp)2224
Transcript length (bp)2130
Coding sequence length (bp)2130
Protein length (aa) 710

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 2.1E-24 173 334
PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2 3.5E-10 35 166

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH20 4.1E-56 166 496

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup7865
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g3306.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g3667.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g5154.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g3040.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g7795.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g1201.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g2271.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g3858.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g4042.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g10172.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g10626.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g8585.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g2682.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g2894.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g1579.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g8101.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g2018.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g8559.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g6859.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g7630.t1 (this protein)
Aspergillus niger CBS 147371 Ani_SJS27_1|g4718.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g3481.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g72.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g2451.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g7630.t1
MRWRALGTLGLVLDFTICGFARLVTVPTIPFDDNNGTYALSQLTKIVVDTRHASTVDTQGQTLIPPTLREFAATF
QEDLRSSLGIDLPLVSSSTSSDNTIFLTLSNNTGFRDVAGRFTAEAYALHIDNNGITISGASPLGVWWGTRSLIQ
AAVVSKHDLPQGSAIDAPGWGTRGVMLDAGRHYYPPDFLIEMCSYLSFFKQNVFHLHLSDNLYNNVDLYSTQESM
DLYAAFRPWSDDPSISGLNKRANESYTRSQFDHIQRQCARRGVTIIPEIEAPGHALAIVQWRPELGLTDLSMLNI
SHPDTIPTMKSIWKTFLPWFHSKTVHLGADEYSSSYVSDYTDFVNDMHTYIAEQSDKDTRIWGTFTPSEGANVSK
AVTIQHWEYFEDNPYFDYIKNNYSVLNSDDAFYIVGKWSGSYPQYLNKTRVFHGDPANNGPYAPNIFSTTNATDN
PPRNNPYVLGHIAALWNDYGPNATTYLEAYYSWRDVLPALADKQWGGNILEEEYDDVFDALHAVIPGQNLDRHVP
SKTDLILHYNFANATGTTVPDLSGNNYHATFNHTCPIDTSNSTIRFTGTCTLTTPIQSKGRDYTLSFSVYPSTTH
PSPLFSGRDSTLLNGNGSISNITLVSGGNPYTLNYSLPVGKWSDVSLIGKSNKTFLSVDGGEKMELLARLGVNGE
SLVWAPIAIEAPVQIIGEGFVGMMREVKLWGSAK*
Coding >Ani_SJS100_1|g7630.t1
ATGCGGTGGAGGGCACTGGGCACACTTGGTCTTGTTCTTGACTTCACCATCTGCGGGTTCGCCCGTCTGGTGACG
GTCCCCACTATTCCATTCGATGATAATAATGGCACCTATGCACTGTCCCAGCTCACCAAGATTGTTGTGGATACT
CGTCACGCCAGTACTGTGGATACTCAAGGCCAAACATTAATCCCGCCAACATTGAGAGAGTTTGCTGCGACGTTC
CAAGAGGACCTTCGATCTTCGCTTGGAATCGATCTCCCACTCGTCTCCAGTAGCACCTCCAGCGACAATACAATC
TTCCTGACCCTCTCCAATAACACGGGCTTCCGCGATGTTGCGGGACGCTTCACAGCGGAGGCATATGCCTTGCAC
ATCGATAATAATGGAATCACCATCTCTGGAGCGAGTCCCCTGGGAGTATGGTGGGGAACGCGCTCGCTAATCCAG
GCTGCTGTGGTCAGCAAACACGACCTTCCTCAGGGCTCTGCAATCGATGCTCCAGGATGGGGAACACGCGGTGTC
ATGCTCGATGCCGGACGTCACTACTACCCACCCGACTTTTTGATCGAAATGTGCTCGTACCTGTCCTTCTTCAAG
CAGAATGTCTTCCACCTCCACCTCAGCGACAATCTCTACAACAACGTCGACCTCTACTCCACCCAGGAATCCATG
GACCTCTACGCAGCATTCCGGCCCTGGTCCGACGATCCCAGCATATCTGGGCTCAACAAACGAGCCAACGAATCC
TACACGCGCAGCCAATTCGATCATATTCAGCGCCAATGCGCCCGTCGCGGTGTCACTATCATCCCTGAGATAGAA
GCCCCCGGGCATGCCCTCGCCATCGTGCAATGGCGACCTGAACTCGGCCTCACTGATCTCAGCATGCTCAACATC
AGCCATCCAGACACCATCCCGACCATGAAATCCATCTGGAAGACCTTCCTCCCCTGGTTCCACAGCAAAACCGTC
CACCTCGGCGCAGACGAATATTCCTCCTCCTACGTATCCGATTACACCGACTTCGTCAACGACATGCATACCTAC
ATCGCCGAGCAATCCGACAAAGACACCCGCATCTGGGGCACCTTCACCCCATCGGAGGGCGCCAACGTCTCCAAA
GCCGTCACCATCCAGCACTGGGAATACTTCGAAGACAACCCCTACTTCGACTACATCAAGAATAACTACTCGGTT
CTCAACTCCGACGATGCCTTCTACATTGTCGGGAAATGGTCCGGAAGCTACCCGCAGTACCTCAACAAGACGCGA
GTCTTCCACGGTGATCCAGCAAACAACGGTCCCTACGCCCCCAACATCTTCTCTACCACCAACGCAACCGATAAT
CCTCCAAGAAATAATCCCTACGTACTCGGCCACATCGCCGCCCTCTGGAACGACTACGGGCCCAACGCAACGACC
TACCTCGAGGCGTATTACTCCTGGCGTGATGTTCTCCCCGCACTAGCGGACAAGCAATGGGGCGGTAATATCCTG
GAAGAAGAATACGATGATGTGTTCGATGCTCTTCATGCTGTGATCCCAGGGCAAAACTTGGATCGCCATGTCCCA
AGCAAGACGGATCTGATTCTACACTACAACTTCGCCAATGCCACCGGAACCACAGTTCCAGATTTATCAGGGAAT
AACTACCACGCCACGTTCAATCACACCTGTCCCATCGATACTTCTAACTCAACAATCAGGTTCACAGGAACATGC
ACCCTCACTACACCTATCCAGAGCAAAGGGAGAGACTATACCCTCTCTTTTTCTGTATATCCTTCCACAACTCAC
CCGTCACCTTTATTCTCGGGGAGAGACTCGACTCTCCTCAACGGCAACGGGTCAATTAGTAATATTACCCTGGTG
AGCGGCGGAAACCCATACACATTGAACTACAGTCTTCCGGTCGGTAAATGGTCGGATGTTAGTTTAATCGGAAAG
AGTAATAAAACTTTTCTTTCCGTTGATGGTGGCGAAAAGATGGAGCTTCTAGCAAGACTAGGGGTGAATGGGGAG
TCGCTAGTGTGGGCGCCCATTGCGATCGAGGCACCAGTGCAGATAATCGGGGAGGGGTTTGTAGGGATGATGAGG
GAGGTTAAGTTGTGGGGGAGTGCGAAGTGA
Transcript >Ani_SJS100_1|g7630.t1
ATGCGGTGGAGGGCACTGGGCACACTTGGTCTTGTTCTTGACTTCACCATCTGCGGGTTCGCCCGTCTGGTGACG
GTCCCCACTATTCCATTCGATGATAATAATGGCACCTATGCACTGTCCCAGCTCACCAAGATTGTTGTGGATACT
CGTCACGCCAGTACTGTGGATACTCAAGGCCAAACATTAATCCCGCCAACATTGAGAGAGTTTGCTGCGACGTTC
CAAGAGGACCTTCGATCTTCGCTTGGAATCGATCTCCCACTCGTCTCCAGTAGCACCTCCAGCGACAATACAATC
TTCCTGACCCTCTCCAATAACACGGGCTTCCGCGATGTTGCGGGACGCTTCACAGCGGAGGCATATGCCTTGCAC
ATCGATAATAATGGAATCACCATCTCTGGAGCGAGTCCCCTGGGAGTATGGTGGGGAACGCGCTCGCTAATCCAG
GCTGCTGTGGTCAGCAAACACGACCTTCCTCAGGGCTCTGCAATCGATGCTCCAGGATGGGGAACACGCGGTGTC
ATGCTCGATGCCGGACGTCACTACTACCCACCCGACTTTTTGATCGAAATGTGCTCGTACCTGTCCTTCTTCAAG
CAGAATGTCTTCCACCTCCACCTCAGCGACAATCTCTACAACAACGTCGACCTCTACTCCACCCAGGAATCCATG
GACCTCTACGCAGCATTCCGGCCCTGGTCCGACGATCCCAGCATATCTGGGCTCAACAAACGAGCCAACGAATCC
TACACGCGCAGCCAATTCGATCATATTCAGCGCCAATGCGCCCGTCGCGGTGTCACTATCATCCCTGAGATAGAA
GCCCCCGGGCATGCCCTCGCCATCGTGCAATGGCGACCTGAACTCGGCCTCACTGATCTCAGCATGCTCAACATC
AGCCATCCAGACACCATCCCGACCATGAAATCCATCTGGAAGACCTTCCTCCCCTGGTTCCACAGCAAAACCGTC
CACCTCGGCGCAGACGAATATTCCTCCTCCTACGTATCCGATTACACCGACTTCGTCAACGACATGCATACCTAC
ATCGCCGAGCAATCCGACAAAGACACCCGCATCTGGGGCACCTTCACCCCATCGGAGGGCGCCAACGTCTCCAAA
GCCGTCACCATCCAGCACTGGGAATACTTCGAAGACAACCCCTACTTCGACTACATCAAGAATAACTACTCGGTT
CTCAACTCCGACGATGCCTTCTACATTGTCGGGAAATGGTCCGGAAGCTACCCGCAGTACCTCAACAAGACGCGA
GTCTTCCACGGTGATCCAGCAAACAACGGTCCCTACGCCCCCAACATCTTCTCTACCACCAACGCAACCGATAAT
CCTCCAAGAAATAATCCCTACGTACTCGGCCACATCGCCGCCCTCTGGAACGACTACGGGCCCAACGCAACGACC
TACCTCGAGGCGTATTACTCCTGGCGTGATGTTCTCCCCGCACTAGCGGACAAGCAATGGGGCGGTAATATCCTG
GAAGAAGAATACGATGATGTGTTCGATGCTCTTCATGCTGTGATCCCAGGGCAAAACTTGGATCGCCATGTCCCA
AGCAAGACGGATCTGATTCTACACTACAACTTCGCCAATGCCACCGGAACCACAGTTCCAGATTTATCAGGGAAT
AACTACCACGCCACGTTCAATCACACCTGTCCCATCGATACTTCTAACTCAACAATCAGGTTCACAGGAACATGC
ACCCTCACTACACCTATCCAGAGCAAAGGGAGAGACTATACCCTCTCTTTTTCTGTATATCCTTCCACAACTCAC
CCGTCACCTTTATTCTCGGGGAGAGACTCGACTCTCCTCAACGGCAACGGGTCAATTAGTAATATTACCCTGGTG
AGCGGCGGAAACCCATACACATTGAACTACAGTCTTCCGGTCGGTAAATGGTCGGATGTTAGTTTAATCGGAAAG
AGTAATAAAACTTTTCTTTCCGTTGATGGTGGCGAAAAGATGGAGCTTCTAGCAAGACTAGGGGTGAATGGGGAG
TCGCTAGTGTGGGCGCCCATTGCGATCGAGGCACCAGTGCAGATAATCGGGGAGGGGTTTGTAGGGATGATGAGG
GAGGTTAAGTTGTGGGGGAGTGCGAAGTGA
Gene >Ani_SJS100_1|g7630.t1
ATGCGGTGGAGGGCACTGGGCACACTTGGTCTTGTTCTTGACTTCACCATCTGCGGTATGTGCCTTGGTTTATCA
TAACTCATGTAGTCTCTTACAATTACAGGGTTCGCCCGTCTGGTGACGGTCCCCACTATTCCATTCGATGATAAT
AATGGCACCTATGCACTGTCCCAGCTCACCAAGATTGTTGTGGATACTCGTCACGCCAGTACTGTGGATACTCAA
GGCCAAACATTAATCCCGCCAACATTGAGAGAGTTTGCTGCGACGTTCCAAGAGGACCTTCGATCTTCGCTTGGA
ATCGATCTCCCACTCGTCTCCAGTAGCACCTCCAGCGACAATACAATCTTCCTGACCCTCTCCAATAACACGGGC
TTCCGCGATGTTGCGGGACGCTTCACAGCGGAGGCATATGCCTTGCACATCGATAATAATGGAATCACCATCTCT
GGAGCGAGTCCCCTGGGAGTATGGTGGGGAACGCGCTCGCTAATCCAGGCTGCTGTGGTCAGCAAACACGACCTT
CCTCAGGGCTCTGCAATCGATGCTCCAGGATGGGGAACACGCGGTGTCATGGTAAGTCCTCCCCATACCACTATA
CAACCAACATCTAACCGATAAGCTCGATGCCGGACGTCACTACTACCCACCCGACTTTTTGATCGAAATGTGCTC
GTACCTGTCCTTCTTCAAGCAGAATGTCTTCCACCTCCACCTCAGCGACAATCTCTACAACAACGTCGACCTCTA
CTCCACCCAGGAATCCATGGACCTCTACGCAGCATTCCGGCCCTGGTCCGACGATCCCAGCATATCTGGGCTCAA
CAAACGAGCCAACGAATCCTACACGCGCAGCCAATTCGATCATATTCAGCGCCAATGCGCCCGTCGCGGTGTCAC
TATCATCCCTGAGATAGAAGCCCCCGGGCATGCCCTCGCCATCGTGCAATGGCGACCTGAACTCGGCCTCACTGA
TCTCAGCATGCTCAACATCAGCCATCCAGACACCATCCCGACCATGAAATCCATCTGGAAGACCTTCCTCCCCTG
GTTCCACAGCAAAACCGTCCACCTCGGCGCAGACGAATATTCCTCCTCCTACGTATCCGATTACACCGACTTCGT
CAACGACATGCATACCTACATCGCCGAGCAATCCGACAAAGACACCCGCATCTGGGGCACCTTCACCCCATCGGA
GGGCGCCAACGTCTCCAAAGCCGTCACCATCCAGCACTGGGAATACTTCGAAGACAACCCCTACTTCGACTACAT
CAAGAATAACTACTCGGTTCTCAACTCCGACGATGCCTTCTACATTGTCGGGAAATGGTCCGGAAGCTACCCGCA
GTACCTCAACAAGACGCGAGTCTTCCACGGTGATCCAGCAAACAACGGTCCCTACGCCCCCAACATCTTCTCTAC
CACCAACGCAACCGATAATCCTCCAAGAAATAATCCCTACGTACTCGGCCACATCGCCGCCCTCTGGAACGACTA
CGGGCCCAACGCAACGACCTACCTCGAGGCGTATTACTCCTGGCGTGATGTTCTCCCCGCACTAGCGGACAAGCA
ATGGGGCGGTAATATCCTGGAAGAAGAATACGATGATGTGTTCGATGCTCTTCATGCTGTGATCCCAGGGCAAAA
CTTGGATCGCCATGTCCCAAGCAAGACGGATCTGATTCTACACTACAACTTCGCCAATGCCACCGGAACCACAGT
TCCAGATTTATCAGGGAATAACTACCACGCCACGTTCAATCACACCTGTCCCATCGATACTTCTAACTCAACAAT
CAGGTTCACAGGAACATGCACCCTCACTACACCTATCCAGAGCAAAGGGAGAGACTATACCCTCTCTTTTTCTGT
ATATCCTTCCACAACTCACCCGTCACCTTTATTCTCGGGGAGAGACTCGACTCTCCTCAACGGCAACGGGTCAAT
TAGTAATATTACCCTGGTGAGCGGCGGAAACCCATACACATTGAACTACAGTCTTCCGGTCGGTAAATGGTCGGA
TGTTAGTTTAATCGGAAAGAGTAATAAAACTTTTCTTTCCGTTGATGGTGGCGAAAAGATGGAGCTTCTAGCAAG
ACTAGGGGTGAATGGGGAGTCGCTAGTGTGGGCGCCCATTGCGATCGAGGCACCAGTGCAGATAATCGGGGAGGG
GTTTGTAGGGATGATGAGGGAGGTTAAGTTGTGGGGGAGTGCGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail