Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g7361.t1
Gene name
Locationscaffold_051:108589..125798
Strand+
Gene length (bp)17209
Transcript length (bp)17025
Coding sequence length (bp)17025
Protein length (aa) 5675

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.8E-72 235 634
PF00501 AMP-binding AMP-binding enzyme 1.5E-68 1342 1742
PF00501 AMP-binding AMP-binding enzyme 6.7E-72 2435 2830
PF00501 AMP-binding AMP-binding enzyme 1.8E-66 3505 3902
PF00501 AMP-binding AMP-binding enzyme 1.3E-73 4622 5016
PF00668 Condensation Condensation domain 1.5E-41 886 1320
PF00668 Condensation Condensation domain 2.3E-32 1995 2390
PF00668 Condensation Condensation domain 4.6E-11 3078 3231
PF00668 Condensation Condensation domain 5.1E-12 3273 3481
PF00668 Condensation Condensation domain 5.7E-45 4169 4601
PF00668 Condensation Condensation domain 1.3E-29 5282 5663
PF00550 PP-binding Phosphopantetheine attachment site 3.3E-10 781 843
PF00550 PP-binding Phosphopantetheine attachment site 9.5E-11 1889 1951
PF00550 PP-binding Phosphopantetheine attachment site 5.0E-09 2975 3033
PF00550 PP-binding Phosphopantetheine attachment site 1.2E-10 4041 4101
PF00550 PP-binding Phosphopantetheine attachment site 2.0E-10 5159 5220

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g7361.t1
MGSIGDLPVGVFPTLVPPSSSGHTEFHAWEISPDILTNLLQSSIRKEVDLIVLLRSIWAIVLRQYVESDGLCFKA
GSMTSACSELDMLVYRAGISSHDTPEGIWRQQQITTGISAGGRNWEVNTGVFLLKLCSDRQWRARAMQAVDACLV
MEEVDANAPRLYFLAKATLLSRQQAQYVADTVAHVASEILRKPNQTLRDTDFFSPQHAPILHKWNHRTFWPGEGD
TPSSILDAIRRHSQRSPDALAIVAWDGSISYGDLEARSTCLAEYLRRVGVGPGVMVPLLLGHSQWVIITQLAVLK
AGAAFVPLEPSHPQERLRYIVRCVKAFLIVASEAHCARAQQLVEQVIPINENIMNTVRTALLSTAYITPTADAPA
YVLFTSGSTGQPKGCVIDHRAMAQLPHDGVAASVGPDSRVLQFATYSFTMAIYEIYWCLSNGGTLCIPSDHDRLN
NLPTVIEEMQVTWAVLTPSVLRRLSHDNPPSSLQTLALGGEPLAAGDMEAWVRKLQVFFGYASSEGTALNCLTEL
SEQSHALEYTPTPRVRHWIVDPDNHDKLAAVGTVGELIVESPGLAREYLDNPTATAAAFIQSPDWRRSFRFSQDA
SQPIRMYKTGDLFRYTERGNLQYVGRKATQVKIRGQRLDLGEVEYNVSQQCPAPARVIAETGVPRDGAGTMLLVA
FLYSDNYTLEQSETTQSDEASLFAVPSDQFRADMKILTQALEPLLPAHMLPGIYIPLRRFPSTLTGKADRRLLRE
LIQQHTRGELERYQSVTTNNVAPPSTRLERDLHGLFAEVLGINAQDFGINHSFIRLGGDSLAAMKLVNLSRKLGL
RLTVAQIMESKTVAKLSNTTLADESSVSTIIPLRDGPLEAKLLLDFWEGIEEEHIESISNCSTIQQGILLGHIRN
PAHYHNRIVWEVLEPPAARDIDRMRRAWAHVCRRHPMLRTFFVEAPAGNSSLALQITLKVSRFRPEDVDVLYEEP
EQMPSTNPTLASEQPLQWIPRLRIYEATGNRLYCAIDIHHVQVDMISLGIIIRDLRRCYLDETEYVAAGDVSEPN
SVSYTDYTQYLVASQSAESLSYWRIRLAHTEPCIFPRLQQGPFEAASSALCSVELPLTPIADHLQSFCKDTEVTV
ATVFKLAWSLVLSAYTGSRCACYGSVTAMRDVPLAGVEDLVGPLINTLPFCVELNPDERVMNVLRRVQNLFLEEL
PHRQVSIAELQHSLNNSSGTLFNTTMSFVDSLDPAADSQHPIRLVSWYGPTEYDLVVEVTPGPPVSCCIRYWSHM
MSDWQASALADTLAMSVSQILRGASSGQSVGSLDLCTARDKQKLVEWNGSPPEAVRVRVHDLIKARCIEQPDALA
VWAWDGALSYRELDCLSSNLARRLMARGVGPEAFVGICFDRCKWTLVSVLAVAKAGGAFCLMDSSHPTYRLREIC
DALGANLVITTPKHVAKVSKCERPLLVVVEGVCSETDDLPGGLGSEYRDTLPRNALYAVFTSGSTGKPKGVVITH
ENLAATIKNCPQRLDLRPGDRSLHFASYAFDFSIIEVIVPMVVGACVCIPSEHDRLNNLPKAMADLAVTWAIMTP
TVSRLLEPASLPTLRTLVLGGEAIMPYDFTTWQGYTTLISAYSPAECTPIGLCTVVQADDPNCLGKPFTSMSPWI
VDPENVQRLVPVGAVGELVIEGTVVGRGYLHDAEHRDIVSSPFIPPTQWLSQYRTIDVTNPSRLYRTGDLVQFTE
DGAVRFIGRKDLQVKIRGQRLELGEVESRLRSYLPWAGAIVVEAVVLKSPGGRAVLVAFISINSPDVTDNAETVC
EIAGSFDNDDNSVYQRDIDKALSHLGDELPNWMVPSVVLKVQGIPMTKSGKVDRRRLRQLATLIPRETLGASNVH
SSLRQAPVTEEERRLQMAFANILQMRPEEIFADSHFFQLGGDSVGAMELVAAARLQNMGISVSEIFQHPTLSELA
AVATKTMDEETSEIPPFSLLPSDYESDIISSALEQCALSLNDLGDIYPCTAFQEGLMALASQKAGKYVCQCLFEL
GRDVEINKLKTAWQATVTANDILRTRIIHVHPHGTFQVVLTPAAAPILWHRYETVNEWRKKDMELNMELGTTLAR
FSILSSAQGQTLVGVSLHHAIYDGVSLPRLFDQVQRAYQNERLPLNKFTPLIRSLILQNPKDVEEFWRTEFHGLQ
TSVFPGLPEPGFVPNPTASVEKEIRLPRPPHLPSVTLSTVMRLAWALLVSYYTDSEDVVFGVTVSGRARSVPGIN
LLTGPSMATVPFRTRICRDSLLLDALRDAQDHSMRMIPFEQAGLQRIRELSDEASVACGFQSQLVIQHGEHSQAS
PNMMILRDQFADHAAFLNYALVILCTPSTAHQTVRVNFQFDPQIVLPAVADRLLSQFAHIVDQMCAPSSYNARLG
GLETITPQDWTSLRQWNGSLPAAYPHPLHHLVLSQAETTPDRRAVESWDGTLTYAELNDLSGKLGQHLLNRGLKQ
GSRVVLLFDRSLISVVTMLAVLRSGGICVNIDPSLPQTRITQTIHQARPSVALVSSTYQSRLADALPVPVLTIAL
DTIPRSAKNIPWPLVRSTDLAFILFTSGTTGKPKGIMVEHGNCATDIFHYSAILAVTPEIRTLHFCSYAFDLSIY
EVLTPWMHGGCLCIPSESARLSDLPGVIQKYHVNFAILTPSVGSALHPSDLPSLQTLILGGEVMPAVMFDRWASH
VRLINLYGPAEATQCAALHLKPTDEFVPGLIGAMVGASGWVTVPGSPNCLTPIGAVGELLIEGPAVTRGYFDEME
QTQASYIDPPAWLQEFRGPAEPGRLFCSGDLVQYVPNRPGWLRYIGRKDKQVKIRAQRVDLTEVEHHVDELLPPG
SQAIAEVLFQHSSPRQSSQLAVFLAFGEQLTNKMDIICALDEPFRRLIAEIHPQLQKRLPSYMVPTLFFPVSHVP
QTPTGKTDRNRLRQLVEGWTTEQLLPYHPFSTDSARAPVETAEERIWQHMWCEVLCIRPENIARTSHFFHLGGES
VRAMRLAGLAQREGWIISVPDIFAHPTLSEMASLAVPSPKGVPVPSPDRFSLVGSGRRASYLVNMATHQCNVTKS
EIEDIYPCTPLQETLIASTVQKGGSYQALEAFDLIADVDLERLEMAWQKTAADHAILRTRIMQDYTGELFQVVVK
GPLAWTAEQADINPENGLLHFQRTMGIGTPLIHLVLLQSPGSTIPDRLLLSIHHALYDGWSLPLLLEEVNQKYIG
PYRGQDTTVPFNELETKTEARLFPRLPDGAYEPHPQAILQDQVFVSPTRNESEITLATMVQASWALTVSCYLNAS
DVGFGITTSGRAAPVPGIDRLLGPTLVTLPRRIHIQNTLDIKLFLRQLQQRFTEQSKYEHIGLQQIRQLGPSAAS
ACRFQTLLVIQPDQPKRQLAWAGNHQSAAELTQFSNVALTLICQLPSPSSTSIGLTAVYDPRVLAPAQMQRVLSQ
VGHVFRELQDAPDGVPIASLNMLNPSDSAELQQWNKLTVPTGKHQDQEFVHDMIRRQCQLQPDAVAVEAWDGSLT
YEELDSYTEYLAAKLQLCGVRNDHFIALYFEKSCWTIVAQLAVLKAGGALVMLEPSHPVDRRREICQTLDVMLIL
GPPHLTHSLEQELNIKVLPISKAHLKASDGEHLSVDSHIQSHNLMYAIATSGTTGCPKLALVHHGGFVATARTLV
DRLLLLASSRVLQFSSYGFDASLVEQLLPLIVGGCVCVPTPFDRDNRLAFTMATMKINWMVAPASVIHLLSPDTV
PTLQTLISAGEPLQQSIIDVWATRVNLINAYGPAECSMVCSVNPSVRPGTDPNNIGYPIGGTCWIVDPNDINTLL
PIGAEGELLVEGPNVGVGYAKDPRRTRVAFSSSPPHWLRSIHGESVHTRIYRTGDIARYNPDGSVLYVGRKDSQI
KLHGQRIELAEVEHHVRLCFPGAIQVVVEMVKFDDFETSSLVALIVVSGSGFPASGSNILLPTTANFLNNVQHAE
ALLQDRIPPYMIPTLFVPVAQIPFNTNGKADRARLRTSVASLSIHDRIGYRSTATTKPNTDLEIVLHGIWSRVLR
ISPQKLGIHESFFRVGGNSISSMQLAAQCNEAGLPISIQDIFRCRTISRLASSFKGHPVQADRSLEAHSQDGSLG
PVQRLLPEVGHPKAPVDSTLAAFTDGQFEEINNGIPAGYEGQIQDIYPCSHAQQGMLISNTRNSSLYQQVYRFEV
VRGCDAPNVDCQQLVRAWHAVVKRHGALRTVFLDIPGRGFHQIVLVNAIDNVIIAADGNHSSTCTQKRPGTQDLY
GPLPTLIIHQEYDERLWIELHISHALLDGVSLRIIEQDLVKAYYNNLPSSLPDYRDYVTYLRAKGDTEMSLSYWK
KYLEGAQPCLFPRLRDSTAAVTDVSEPKATVDFVSLDLGPPKSLDQLCETHCLSLTAILHVVWAIVLQQYTGTDS
VCFGYATSARHVPIPHVDEIVGPMINTLPSQIQLSRDSSVLSTLQKYTVHFMSCMEHAYVSLGQILHSAMSSTQS
PFNTMITIVETGDRRDDADGSCLSLVCMDGHGETEYALALTVSKASSRMDLHLSYQTSMVNASQAHDVCLMFQKV
LCEVLEWPTAKIGAIDALNMGQRQRMESRQPTPPAAANTLIYETINRRCAEQPSSSAVCAWDGEFTYGEIDQLSS
VLAGEILAHGVKPEDPVLVCLEKSRWVPVVMLAVWKAGACLILLDATHPTTRLHMIAKQSAASLAIANRSTRSKA
NILCSRVLQVDDDRLWTRHVNSSRAEMVHVDGHSAAYIIFTSGSTGTPKGAVIEHASLSIAWETLITRLQLNPTS
RVLQFASHSWDAAIIDVMAALMSGGCLCVPSENERMGHLALAANRMRANWMLLTPTVARQLTPSEFLYLETLVLG
GERVNTTDIEVWHDKVCLLSAYGPAECTQITSVTRPLDMTCDARNIGVPNASAGWVVRPDDPEQLVPDGAIGELL
IEGPIVGQGYLNEPQRTYQAFIEAPSWLQAIRSPGTIRVYRTGDLVRFAADGSLIFVGRMDDQVKLHGQRLELGE
VEHHVQQAFAASLTVIDLIQPKEEQQMGPFLAACIFSPGHACKSPSHAGIWEPPSDTFRKKVQEARTALYQSLPS
YMVPSVFLPLAYLPKSTTGKIDRKRLRNYILDMSQEELITYSSPDVNWVASVLTLMETRLQDHISSILHKQPWQV
SPDQDLFQLGMDSVLAMALIARLYKDGLKLTVRDIFEQPQLRNLALVVRETLRPDQEGVRKAHSRSPLLHYAKEI
ADEWKMALTSIEHILPTTRFQRESLEARHKVYFIFHFHGKIDCQRLQHAVQAAVDKYAILRTVFIPWDESTVQIT
LGDATVPVEITTTDLNPVEIAGSICREDSSAPVAPGKLHTQLRLIMGSNRDSMALRLSHAQYDGISMPRLFTDIA
RAYQGITLSPAKVDFPEYLHSRIYNIPSQAYKFWRDLLRGSSMTYLRSESSSGSPPSHNRGSLITSTTEVSYPPA
PAGTTMATVAKAAWALCLAHMAGTHDIVFGQLVNGRNLELPEAETVVGACVNYVPVRVTLQADWTVSSLLHAVHQ
QQTRSMAFETLEYDELVAQCTSWPADTDPGTGIHYVNIPDAFAGSGLPGVGSDYETYVSRLPYYHPRVTCSPLSK
GILELTLSVSDQLWDQNQADQTLHLFGQTVVRILENPTGLACDVLKALV*
Coding >Ani_SJS100_1|g7361.t1
ATGGGAAGTATAGGAGACCTGCCCGTGGGGGTATTTCCCACGCTGGTACCCCCGAGCTCTAGTGGTCACACAGAA
TTCCATGCCTGGGAGATTTCCCCGGACATCCTCACAAATCTTCTGCAAAGCAGTATCCGAAAGGAAGTTGATCTG
ATAGTGCTGTTGCGTAGCATCTGGGCCATTGTTCTCCGCCAATATGTCGAGTCAGACGGGCTGTGCTTCAAGGCG
GGAAGCATGACTTCAGCTTGCTCTGAGTTGGATATGCTGGTCTATCGAGCTGGCATCTCTTCACATGACACCCCA
GAAGGTATCTGGAGACAGCAGCAAATAACGACCGGTATCAGTGCGGGAGGTCGGAACTGGGAGGTGAATACTGGT
GTCTTTCTACTCAAGCTGTGCAGTGATAGGCAATGGAGAGCCAGAGCAATGCAAGCTGTGGATGCTTGCTTGGTT
ATGGAAGAAGTGGATGCCAATGCTCCTCGTCTCTATTTCCTGGCGAAAGCGACATTATTATCCAGACAGCAGGCT
CAGTATGTTGCAGATACTGTCGCTCATGTCGCCTCAGAGATCCTGCGCAAGCCCAACCAGACACTCAGGGATACG
GATTTCTTTAGTCCCCAACATGCACCAATCCTACACAAGTGGAACCACCGTACCTTCTGGCCTGGCGAGGGCGAC
ACTCCCTCTTCCATCCTGGACGCCATTCGACGACATAGTCAGCGGAGCCCCGACGCGCTCGCTATTGTCGCTTGG
GATGGCAGTATTTCCTACGGAGATCTCGAGGCACGCAGCACGTGTCTGGCAGAGTATCTGCGTCGTGTCGGTGTT
GGCCCGGGTGTCATGGTGCCCCTGCTTCTAGGCCACAGCCAATGGGTCATCATCACCCAATTGGCCGTCCTCAAA
GCCGGAGCAGCCTTTGTACCCCTGGAGCCATCGCATCCACAGGAGAGATTGCGATATATAGTGCGCTGTGTGAAA
GCCTTCTTGATTGTGGCGTCCGAGGCGCATTGCGCTCGGGCTCAACAGCTGGTTGAGCAAGTCATCCCGATTAAC
GAGAACATCATGAATACAGTGCGTACCGCACTCCTGTCGACGGCGTACATAACTCCGACTGCAGACGCTCCGGCA
TATGTCCTTTTCACCTCGGGCAGTACCGGGCAGCCCAAAGGCTGTGTGATCGACCACCGTGCGATGGCCCAACTC
CCCCATGATGGTGTAGCAGCGTCAGTGGGACCTGACTCACGTGTGCTGCAATTTGCGACCTATAGCTTCACCATG
GCCATCTATGAGATATATTGGTGTTTGAGTAATGGCGGGACACTCTGTATCCCCTCAGACCATGACAGGTTGAAC
AATCTTCCTACCGTGATCGAGGAGATGCAAGTCACCTGGGCCGTGCTGACTCCGTCAGTACTGCGACGGCTGAGC
CACGATAACCCCCCATCTAGTTTGCAGACGCTTGCCCTAGGCGGAGAGCCGTTGGCTGCCGGGGATATGGAGGCC
TGGGTGCGAAAGCTGCAAGTGTTTTTCGGTTATGCGTCTAGTGAAGGGACGGCACTGAATTGCCTGACGGAGCTG
AGCGAGCAATCACATGCCTTAGAGTATACGCCTACCCCCCGGGTTCGTCACTGGATCGTTGATCCCGACAACCAT
GATAAACTCGCGGCAGTGGGCACAGTTGGGGAGTTGATCGTTGAGAGTCCCGGACTCGCCCGCGAATACCTGGAC
AATCCAACCGCTACTGCCGCCGCATTCATTCAAAGTCCCGACTGGAGAAGGTCATTTCGATTTTCCCAGGATGCG
AGCCAACCGATCCGTATGTATAAAACCGGAGACCTCTTCCGCTATACGGAAAGGGGCAACCTGCAGTACGTTGGC
CGGAAGGCCACGCAAGTCAAGATCCGCGGCCAACGTTTGGATCTGGGAGAAGTCGAATACAACGTCAGCCAACAG
TGTCCTGCACCCGCCCGAGTGATTGCAGAGACAGGGGTCCCGAGAGATGGGGCAGGGACAATGTTACTAGTCGCG
TTTCTTTATTCGGACAACTACACATTAGAGCAATCAGAAACGACGCAGTCAGATGAGGCCTCTCTATTTGCTGTC
CCCTCCGATCAGTTCCGCGCCGACATGAAGATTTTAACACAAGCATTAGAACCATTGTTACCGGCCCATATGCTT
CCTGGCATCTACATTCCTCTGCGACGCTTCCCATCGACGTTGACGGGCAAAGCCGACCGTCGTCTGTTACGCGAA
CTGATCCAGCAGCACACTCGTGGCGAGTTGGAGCGTTACCAGTCTGTGACGACTAATAATGTAGCGCCTCCAAGC
ACTCGCCTGGAGCGAGACCTTCACGGCCTTTTCGCCGAGGTACTGGGGATAAATGCTCAGGACTTCGGGATTAAT
CACAGCTTCATACGTCTGGGAGGAGATTCTCTCGCCGCGATGAAGCTGGTCAATTTGAGCCGTAAGCTAGGCCTG
CGCTTGACAGTCGCGCAGATTATGGAGAGCAAGACTGTTGCCAAGCTGAGCAACACAACGTTGGCCGACGAGTCT
TCTGTTAGCACGATAATCCCTCTGAGGGATGGCCCTCTCGAAGCCAAACTTCTGCTCGACTTTTGGGAAGGTATC
GAAGAAGAACACATCGAATCCATTTCCAACTGCTCCACCATCCAGCAGGGCATTCTATTGGGACACATTCGAAAC
CCAGCCCACTACCATAATCGAATAGTGTGGGAAGTCCTTGAGCCCCCTGCAGCACGAGATATCGATCGAATGCGC
CGTGCATGGGCGCACGTTTGCCGCCGTCACCCCATGCTACGTACCTTTTTCGTGGAAGCTCCAGCCGGAAACAGC
TCCCTGGCGCTTCAAATCACGCTGAAAGTGTCCCGCTTCCGCCCTGAGGATGTGGATGTGTTGTATGAGGAGCCT
GAACAAATGCCCAGCACGAATCCCACTCTAGCCTCTGAACAGCCCCTACAGTGGATTCCCCGATTACGAATCTAT
GAGGCTACCGGCAATCGGCTATACTGTGCAATCGATATTCATCATGTTCAGGTGGACATGATCTCCTTGGGGATA
ATTATCCGAGATCTGAGGCGTTGCTATCTGGATGAGACTGAGTATGTTGCAGCGGGCGACGTGTCTGAACCCAAC
AGTGTGTCATACACCGACTACACCCAGTATCTCGTTGCATCCCAGTCAGCGGAGAGTCTCAGTTACTGGAGAATT
CGCCTAGCTCATACGGAGCCGTGTATATTTCCCCGCCTGCAGCAGGGCCCGTTTGAGGCCGCTTCGTCAGCCCTT
TGCAGTGTAGAGCTCCCTCTGACGCCGATAGCTGACCATCTGCAGTCATTCTGCAAGGATACGGAAGTCACCGTG
GCCACGGTGTTCAAGCTTGCCTGGTCACTGGTGCTAAGCGCATATACTGGGTCTCGCTGTGCCTGTTATGGTTCG
GTGACGGCAATGAGAGATGTCCCTTTAGCGGGTGTCGAAGATCTGGTCGGGCCACTAATCAACACGCTGCCGTTT
TGTGTGGAATTGAACCCTGACGAAAGAGTGATGAATGTGCTTCGACGGGTCCAAAATCTATTCCTCGAAGAACTA
CCACACCGACAAGTATCCATTGCAGAACTTCAACATTCCCTAAATAATAGCAGCGGTACTCTCTTCAACACCACA
ATGAGCTTTGTCGACAGCTTAGACCCTGCAGCAGATTCCCAACACCCTATACGATTGGTCTCCTGGTACGGACCG
ACTGAATATGACCTCGTAGTTGAAGTAACTCCAGGGCCCCCCGTCTCGTGCTGCATCAGATACTGGAGCCATATG
ATGTCCGACTGGCAAGCATCCGCTCTCGCAGATACTCTAGCCATGTCGGTTTCGCAGATTCTACGTGGTGCATCT
TCAGGCCAGTCCGTCGGAAGCCTCGATCTATGTACGGCCCGAGATAAGCAGAAGCTCGTTGAATGGAATGGGTCT
CCCCCGGAGGCCGTGCGGGTGCGTGTGCACGATTTGATCAAGGCTCGATGCATCGAGCAGCCAGATGCCTTGGCG
GTGTGGGCCTGGGATGGTGCTTTGAGCTATCGGGAGCTCGACTGTCTTTCCTCGAATCTAGCTAGAAGGCTTATG
GCCCGTGGGGTCGGGCCTGAAGCGTTTGTCGGTATTTGTTTTGACCGGTGCAAATGGACGTTGGTATCGGTTCTA
GCTGTCGCCAAAGCTGGGGGTGCATTTTGCCTGATGGACTCGTCGCATCCGACATATCGCCTGCGCGAAATCTGT
GATGCCTTGGGAGCAAATTTAGTGATCACGACACCAAAACATGTCGCAAAGGTATCCAAATGCGAACGTCCCTTG
TTGGTAGTAGTGGAGGGTGTGTGTTCTGAAACAGACGATTTGCCAGGTGGATTGGGGTCCGAATATCGTGACACA
CTTCCTCGAAATGCCCTATATGCAGTCTTCACATCCGGCTCGACGGGAAAGCCCAAAGGCGTCGTTATCACACAC
GAGAATCTGGCTGCAACAATCAAAAATTGCCCTCAACGGTTGGACCTACGACCAGGCGATCGGTCTCTTCATTTT
GCGTCTTACGCCTTTGACTTCAGTATCATCGAGGTTATAGTTCCCATGGTAGTGGGGGCCTGCGTCTGCATTCCA
TCGGAGCATGACCGTTTGAATAATTTGCCCAAGGCCATGGCGGACCTTGCGGTAACCTGGGCGATTATGACCCCG
ACGGTGTCTCGGTTACTAGAACCTGCCAGCCTACCCACCCTTCGAACTTTAGTCCTTGGAGGAGAGGCAATCATG
CCTTATGATTTCACGACCTGGCAGGGTTACACGACCCTCATCAGCGCATATAGTCCGGCTGAATGCACGCCGATT
GGACTTTGCACTGTGGTTCAGGCGGATGATCCGAACTGTTTGGGCAAGCCATTCACTTCTATGTCGCCCTGGATC
GTTGACCCAGAAAATGTTCAGCGGTTGGTCCCGGTCGGTGCTGTAGGAGAGCTCGTCATAGAAGGGACCGTCGTC
GGTCGAGGCTATCTACACGATGCAGAGCACCGTGATATAGTCTCCTCACCGTTCATCCCTCCGACTCAGTGGCTA
TCCCAATATCGAACCATCGACGTGACTAACCCTTCGCGCTTATATCGCACCGGGGACCTTGTCCAATTTACTGAG
GACGGGGCGGTACGATTTATCGGGCGCAAGGACTTGCAGGTCAAGATCCGGGGCCAGCGACTGGAATTGGGCGAA
GTGGAATCTCGACTCCGAAGCTACCTCCCTTGGGCTGGCGCAATTGTCGTCGAAGCTGTTGTCTTGAAATCCCCC
GGTGGTCGCGCAGTACTGGTCGCCTTTATATCCATTAACTCCCCAGATGTTACAGACAACGCCGAGACAGTGTGC
GAGATAGCCGGATCGTTTGATAATGATGACAATAGTGTATATCAGCGTGATATCGATAAGGCTCTTTCACATCTT
GGGGATGAGCTACCGAACTGGATGGTCCCTTCGGTGGTTCTGAAGGTGCAGGGCATCCCAATGACCAAATCCGGA
AAAGTTGATCGACGCAGACTGCGACAACTAGCTACCCTGATTCCCCGAGAGACGCTAGGGGCCTCTAATGTCCAT
AGTTCTCTTCGTCAAGCTCCAGTCACCGAAGAAGAGAGACGGCTACAGATGGCTTTCGCGAACATCTTGCAAATG
CGGCCTGAGGAGATATTCGCTGACAGTCACTTTTTCCAACTTGGGGGTGATTCTGTTGGAGCCATGGAGCTGGTG
GCAGCGGCGAGGCTACAGAATATGGGAATCAGTGTCAGTGAGATTTTCCAGCATCCTACATTGAGTGAGCTGGCA
GCGGTGGCAACCAAGACCATGGATGAGGAGACTTCTGAGATTCCGCCCTTCAGCCTTCTACCCAGTGACTACGAA
TCGGATATCATCTCATCCGCTCTAGAGCAATGTGCTCTATCGCTGAATGACTTGGGTGATATCTATCCGTGTACC
GCCTTTCAGGAAGGGTTAATGGCCCTTGCCAGTCAAAAAGCTGGCAAGTACGTCTGTCAGTGTCTATTTGAGCTC
GGACGTGATGTTGAGATAAATAAATTGAAGACCGCGTGGCAAGCAACAGTGACTGCCAATGATATCCTCCGCACC
CGGATTATTCACGTTCACCCGCACGGTACCTTCCAGGTGGTCCTGACGCCAGCCGCAGCTCCGATTTTGTGGCAC
AGATATGAGACCGTCAATGAATGGCGCAAGAAGGATATGGAACTGAACATGGAACTGGGAACCACATTGGCTCGC
TTTAGCATCCTCAGCTCGGCCCAGGGACAGACACTCGTAGGTGTCTCTCTCCATCATGCCATTTACGATGGCGTC
TCCCTGCCCCGACTCTTTGACCAGGTGCAAAGGGCATATCAGAATGAACGTCTACCCCTCAATAAATTCACACCC
TTGATTCGCTCTCTAATCTTGCAGAATCCTAAGGATGTTGAAGAATTCTGGCGCACCGAGTTCCATGGTCTTCAG
ACTTCGGTATTCCCAGGTTTGCCCGAGCCTGGATTTGTGCCCAACCCTACAGCGAGCGTGGAAAAGGAGATCAGG
CTCCCACGGCCACCGCACCTGCCAAGTGTTACCCTTTCAACAGTAATGAGGCTGGCATGGGCACTGCTGGTATCA
TATTATACAGATTCTGAGGATGTGGTCTTTGGCGTCACCGTCAGTGGTCGAGCGCGGTCTGTTCCTGGGATAAAC
CTTCTAACTGGCCCTTCTATGGCCACTGTTCCATTCCGCACGCGAATTTGTCGTGATAGTCTACTTCTGGACGCT
CTGCGTGATGCTCAGGACCATTCCATGCGCATGATTCCCTTTGAGCAGGCAGGTCTGCAAAGGATCCGAGAGCTC
AGCGATGAAGCTAGCGTTGCCTGCGGATTTCAGTCACAGTTGGTCATTCAACATGGCGAGCATAGCCAGGCCTCC
CCTAACATGATGATACTGCGTGATCAGTTTGCGGATCATGCGGCGTTTCTCAACTACGCACTGGTTATATTGTGC
ACCCCATCAACGGCACATCAAACCGTACGCGTGAACTTTCAGTTCGATCCGCAAATTGTACTGCCGGCGGTCGCA
GATCGACTGCTGAGCCAATTTGCCCATATCGTGGATCAGATGTGTGCGCCATCTAGCTACAACGCTAGGCTCGGG
GGCCTCGAAACAATAACTCCCCAAGATTGGACCTCGCTGCGGCAATGGAACGGCAGCCTACCAGCCGCATACCCT
CATCCGCTTCATCATCTCGTACTGTCGCAGGCGGAGACCACACCCGACAGGCGGGCCGTGGAGTCATGGGATGGA
ACCTTGACATATGCTGAATTGAATGATCTCTCGGGAAAGCTAGGGCAGCATCTGTTGAACCGTGGACTGAAACAG
GGTTCACGGGTGGTTCTCCTTTTTGACCGCTCCCTCATATCGGTTGTGACAATGTTGGCAGTGCTTCGGTCAGGA
GGCATATGTGTCAACATTGACCCATCTCTACCGCAGACTCGCATTACCCAGACAATACACCAAGCACGGCCCTCA
GTGGCATTGGTATCATCTACATATCAGTCGCGGCTGGCAGATGCATTGCCGGTTCCTGTCCTCACGATTGCACTG
GATACCATACCACGAAGCGCAAAGAACATCCCTTGGCCACTTGTGCGCTCTACTGACCTTGCATTTATTCTCTTC
ACTTCCGGTACCACGGGAAAGCCCAAAGGCATCATGGTAGAACATGGAAATTGCGCTACCGACATTTTTCACTAC
AGTGCTATCTTGGCCGTCACCCCGGAAATAAGAACACTACATTTCTGTAGCTATGCATTTGACTTGAGTATCTAC
GAGGTTCTGACACCCTGGATGCACGGCGGATGTCTGTGCATCCCATCAGAGTCTGCACGGCTTTCAGATTTGCCC
GGAGTCATCCAGAAATACCACGTCAACTTCGCAATCCTGACTCCATCCGTGGGGAGTGCGCTACATCCAAGTGAC
CTTCCCAGCCTGCAAACCCTCATCCTGGGTGGTGAAGTGATGCCTGCGGTGATGTTCGACCGCTGGGCCTCTCAT
GTACGCTTGATCAACTTGTATGGCCCAGCAGAGGCCACCCAGTGTGCCGCTCTCCACCTGAAACCCACAGACGAG
TTTGTGCCAGGACTTATTGGTGCTATGGTTGGCGCCTCGGGCTGGGTCACGGTCCCTGGCAGTCCAAATTGCCTC
ACCCCCATTGGTGCGGTGGGCGAGCTCCTGATAGAAGGCCCAGCGGTAACTCGGGGCTATTTTGACGAAATGGAA
CAGACGCAAGCATCATATATCGATCCGCCAGCCTGGTTGCAGGAGTTTCGCGGGCCTGCTGAGCCTGGCCGCCTC
TTCTGCTCTGGAGACCTGGTGCAGTATGTACCTAACCGGCCAGGTTGGCTGCGCTACATTGGACGCAAGGATAAG
CAAGTCAAAATCCGTGCACAAAGGGTCGACCTGACGGAAGTCGAGCACCATGTCGATGAGCTACTCCCACCAGGC
AGTCAGGCAATTGCCGAGGTCCTGTTCCAGCACTCGTCTCCCCGCCAATCGAGCCAGCTTGCAGTATTCTTGGCC
TTTGGTGAACAGTTAACCAACAAAATGGACATCATATGCGCCCTCGATGAGCCATTCAGAAGATTAATAGCTGAA
ATCCACCCACAGCTTCAGAAAAGGCTCCCTTCTTACATGGTCCCCACCCTCTTCTTTCCGGTATCTCACGTTCCT
CAAACACCCACCGGTAAGACCGATCGAAATCGGTTGCGGCAGTTGGTAGAAGGGTGGACGACCGAACAGCTGCTG
CCATATCATCCGTTCAGTACAGATTCAGCGCGTGCGCCAGTAGAGACGGCTGAGGAGCGCATCTGGCAGCACATG
TGGTGCGAGGTACTCTGCATACGTCCCGAGAATATCGCCAGAACTAGTCATTTCTTTCACCTTGGCGGTGAGTCT
GTTAGAGCGATGAGGTTGGCCGGGTTGGCACAACGTGAGGGATGGATCATTTCCGTGCCAGATATTTTCGCTCAT
CCGACGCTATCGGAAATGGCGAGTCTCGCTGTACCCTCCCCCAAGGGTGTGCCGGTTCCATCTCCAGACCGTTTC
AGCCTGGTAGGAAGCGGAAGGCGGGCATCATATCTGGTTAATATGGCGACTCACCAGTGCAACGTCACCAAAAGT
GAGATAGAGGATATATATCCTTGTACCCCGCTCCAGGAGACTCTCATAGCCTCAACGGTACAAAAAGGAGGCTCC
TACCAAGCGCTGGAAGCCTTTGATCTGATAGCCGATGTGGATTTGGAACGCTTGGAAATGGCGTGGCAAAAGACA
GCGGCCGATCATGCTATCCTCCGCACGCGAATTATGCAAGACTATACCGGCGAACTGTTTCAGGTGGTAGTCAAA
GGTCCGTTAGCATGGACCGCGGAACAAGCGGACATAAACCCTGAGAATGGGTTACTGCATTTCCAGCGTACCATG
GGCATTGGGACACCCTTGATTCATCTAGTCCTTCTACAATCTCCCGGATCCACGATACCCGATCGTCTCTTGCTC
TCGATACATCACGCATTGTACGATGGATGGTCCCTGCCCCTGTTGCTCGAGGAGGTCAATCAGAAATACATCGGC
CCATATCGGGGCCAAGACACAACCGTGCCTTTCAACGAGTTGGAAACGAAGACAGAAGCTCGACTATTTCCACGT
TTGCCGGACGGGGCATACGAGCCACACCCACAGGCTATTTTGCAGGACCAAGTCTTTGTTAGCCCGACGCGGAAT
GAATCTGAGATAACCCTCGCAACCATGGTCCAGGCATCTTGGGCATTGACAGTGAGTTGCTACTTGAACGCAAGC
GATGTAGGGTTCGGGATCACCACCTCTGGACGAGCTGCCCCTGTTCCGGGAATCGATCGACTGTTGGGACCTACG
CTGGTTACATTGCCCCGACGCATACATATCCAGAACACCCTGGATATCAAACTTTTCCTACGGCAACTACAGCAG
CGCTTTACGGAGCAGTCCAAGTATGAACACATTGGACTGCAGCAGATTCGCCAGCTAGGGCCATCGGCGGCCAGC
GCGTGTCGCTTCCAGACTCTCCTAGTCATTCAGCCCGACCAGCCAAAGCGCCAGCTGGCTTGGGCTGGAAACCAC
CAGAGTGCGGCCGAATTGACGCAGTTTAGCAATGTTGCGTTAACCCTGATCTGCCAGCTCCCCTCTCCCTCCTCG
ACGTCCATTGGCCTGACAGCAGTTTACGACCCTCGAGTACTGGCACCCGCACAGATGCAGCGGGTTCTGTCGCAA
GTTGGCCATGTCTTCAGAGAGTTACAGGATGCTCCAGACGGTGTTCCCATCGCCTCGCTCAATATGCTGAACCCC
AGTGACTCCGCAGAACTGCAACAGTGGAATAAGCTCACTGTTCCTACTGGAAAGCATCAAGATCAAGAATTTGTG
CATGACATGATACGGCGGCAATGCCAGCTTCAACCAGACGCCGTAGCCGTTGAGGCATGGGACGGAAGCCTCACT
TATGAAGAGCTGGATTCCTACACGGAGTACCTGGCTGCGAAACTGCAGCTATGTGGTGTTCGCAACGACCACTTC
ATTGCTCTCTACTTCGAGAAGTCATGTTGGACCATTGTCGCCCAACTGGCGGTCCTGAAAGCCGGAGGGGCCCTA
GTGATGCTAGAGCCTTCTCATCCCGTTGATCGCCGTCGGGAGATTTGCCAGACTTTGGATGTCATGTTAATCCTT
GGTCCTCCTCACCTCACTCATTCGTTGGAACAGGAGCTCAATATCAAGGTACTACCTATCAGCAAGGCTCATCTC
AAAGCGTCGGATGGGGAACATCTATCAGTCGACAGTCATATACAGTCTCATAACCTCATGTATGCCATCGCTACA
TCCGGGACTACTGGTTGTCCTAAGCTCGCATTGGTTCATCATGGCGGTTTTGTTGCCACTGCAAGGACCTTGGTT
GATAGGCTCCTCTTACTGGCATCGTCTCGGGTGCTTCAATTCTCTAGTTACGGATTCGACGCAAGCTTAGTGGAA
CAACTGCTTCCGTTAATTGTAGGAGGCTGCGTCTGTGTTCCCACCCCCTTTGACCGTGATAACCGCCTAGCGTTC
ACGATGGCGACCATGAAGATCAATTGGATGGTTGCACCAGCATCAGTGATTCACCTACTTTCACCTGATACGGTC
CCAACACTACAGACATTAATATCTGCGGGTGAGCCATTGCAGCAAAGTATAATCGATGTGTGGGCCACTCGAGTC
AACCTCATAAATGCATACGGCCCAGCAGAGTGCAGTATGGTGTGCTCGGTCAACCCAAGCGTAAGGCCGGGAACC
GATCCGAACAATATCGGATACCCAATTGGTGGCACCTGTTGGATAGTAGACCCAAATGATATCAACACCCTTTTG
CCAATTGGTGCTGAAGGAGAACTCCTGGTGGAAGGGCCGAACGTCGGTGTCGGATATGCGAAAGACCCTCGGCGC
ACAAGAGTTGCATTTTCATCATCACCGCCTCACTGGCTCCGCTCCATTCACGGAGAATCAGTCCACACTCGAATA
TACCGCACAGGAGATATCGCTCGATATAATCCCGACGGATCTGTGCTTTACGTGGGCCGTAAGGATTCACAAATC
AAATTACATGGGCAGCGGATCGAGCTCGCCGAGGTGGAACATCATGTCAGGCTATGTTTCCCAGGCGCCATCCAG
GTAGTTGTTGAGATGGTCAAGTTTGACGATTTTGAAACTAGCTCCCTCGTTGCCCTCATCGTCGTGTCTGGCTCA
GGCTTTCCAGCGTCTGGATCAAACATCCTGCTCCCAACAACCGCAAATTTCCTCAACAATGTTCAACACGCGGAA
GCACTCCTGCAGGATCGTATCCCACCCTATATGATCCCGACGCTGTTCGTACCGGTGGCACAGATTCCCTTCAAT
ACCAATGGCAAGGCAGATCGTGCTCGTCTGAGAACCTCGGTTGCTTCTCTGTCCATCCATGATCGTATAGGCTAT
CGCTCCACGGCCACAACAAAGCCTAACACAGATCTAGAAATTGTGCTTCATGGAATCTGGTCCCGTGTTTTGCGG
ATCTCACCTCAGAAGCTTGGCATCCATGAAAGCTTCTTTCGGGTAGGCGGCAATTCTATTAGCAGTATGCAACTA
GCGGCGCAGTGCAACGAGGCTGGCCTTCCAATATCCATCCAGGATATCTTCCGTTGCCGAACAATTTCGCGGTTG
GCGTCATCATTCAAGGGTCATCCTGTCCAGGCGGACAGATCTTTAGAAGCACATAGCCAGGATGGATCACTGGGC
CCAGTGCAGCGGCTGCTGCCTGAAGTAGGGCACCCCAAGGCTCCAGTGGATTCTACTCTTGCCGCCTTCACTGAT
GGCCAGTTCGAGGAGATAAATAACGGCATCCCGGCTGGATATGAAGGGCAGATACAAGATATCTACCCCTGCTCC
CATGCACAGCAGGGCATGCTCATCAGCAACACACGCAACTCCAGCCTCTATCAGCAAGTCTATCGCTTTGAAGTG
GTTAGAGGTTGTGATGCGCCCAACGTTGACTGTCAGCAGTTGGTAAGGGCGTGGCATGCGGTAGTCAAGCGACAT
GGAGCCCTGCGGACCGTTTTCCTTGATATACCAGGGAGAGGGTTCCACCAGATCGTGCTCGTCAATGCAATAGAC
AATGTCATAATTGCGGCTGACGGCAACCATAGCAGTACATGTACCCAAAAGAGACCTGGTACACAAGACCTGTAT
GGTCCTTTACCAACTCTAATTATTCACCAGGAGTATGATGAGCGGCTTTGGATCGAACTGCATATAAGTCATGCT
CTTCTAGATGGAGTGTCACTGCGAATCATCGAACAAGACCTCGTGAAAGCATACTACAACAACCTACCCTCTTCA
TTACCTGACTATCGGGATTACGTCACCTATCTGCGGGCAAAAGGAGATACGGAAATGTCATTGAGCTACTGGAAA
AAATACCTGGAGGGTGCGCAGCCCTGCCTCTTTCCACGCCTCCGTGACTCTACAGCAGCAGTGACAGACGTGTCG
GAGCCAAAGGCGACAGTCGACTTCGTGTCGCTTGACTTGGGCCCTCCGAAGTCTCTTGATCAGTTGTGTGAGACT
CATTGCCTGAGCCTTACCGCTATCTTGCATGTAGTTTGGGCCATTGTGCTGCAGCAATATACCGGAACGGACAGC
GTGTGCTTTGGATATGCCACATCCGCGCGGCATGTCCCCATCCCTCATGTGGATGAAATAGTTGGTCCAATGATC
AACACGCTGCCCAGTCAAATCCAACTCTCTAGGGATTCATCAGTACTGTCCACTTTACAAAAGTACACCGTTCAC
TTCATGTCCTGCATGGAGCATGCCTACGTCTCACTTGGACAGATATTACACTCGGCTATGTCCAGTACACAATCA
CCCTTCAACACAATGATAACTATTGTTGAGACTGGAGATCGTAGAGACGACGCTGATGGATCCTGCTTATCGTTG
GTTTGTATGGATGGACATGGGGAGACAGAGTATGCGTTGGCCTTGACTGTTTCCAAAGCATCGAGCCGCATGGAT
TTGCACCTTTCATACCAAACATCCATGGTCAATGCTTCTCAGGCCCATGATGTGTGCCTGATGTTTCAAAAAGTC
CTGTGTGAGGTCTTGGAGTGGCCCACGGCCAAGATTGGTGCCATTGATGCCCTGAATATGGGTCAGAGACAGCGC
ATGGAATCGAGGCAGCCTACCCCACCGGCTGCTGCAAATACATTGATATACGAAACCATCAATCGGCGATGTGCA
GAGCAACCATCCTCATCAGCCGTCTGTGCCTGGGATGGTGAATTTACCTACGGGGAAATTGATCAGCTCTCATCA
GTATTGGCGGGAGAGATCCTTGCCCATGGAGTTAAACCGGAGGACCCGGTTTTGGTATGCCTTGAAAAGAGCCGC
TGGGTTCCGGTGGTTATGCTGGCAGTCTGGAAAGCCGGGGCATGCTTAATTCTTCTGGATGCCACCCATCCAACT
ACCCGATTGCATATGATTGCCAAGCAATCTGCCGCATCACTGGCAATTGCAAATAGAAGTACGCGCTCCAAAGCA
AACATCCTGTGCTCACGAGTATTGCAAGTCGATGATGACCGCTTGTGGACTCGACATGTTAACTCCTCGCGGGCC
GAGATGGTTCATGTTGACGGACACAGCGCTGCATACATTATATTCACATCTGGCTCGACTGGAACACCCAAAGGG
GCTGTGATTGAACATGCTTCCCTTTCCATTGCGTGGGAGACCCTCATTACTCGACTACAGTTAAACCCGACATCG
CGTGTTCTACAGTTTGCCTCCCATTCCTGGGATGCGGCAATCATCGATGTTATGGCCGCATTGATGTCAGGAGGC
TGTCTCTGTGTACCCTCGGAAAACGAACGTATGGGGCATTTGGCCTTAGCTGCGAATCGTATGCGAGCCAATTGG
ATGCTACTGACCCCAACTGTCGCCCGTCAGCTTACTCCTAGCGAGTTTCTTTACCTCGAAACGCTAGTCCTTGGC
GGCGAACGGGTCAATACAACGGACATTGAAGTCTGGCATGATAAAGTCTGTCTCCTGAGCGCATATGGCCCAGCA
GAGTGCACGCAAATCACGAGCGTGACGAGGCCGTTAGATATGACCTGTGATGCGCGGAACATCGGCGTCCCAAAT
GCCAGCGCTGGATGGGTTGTACGTCCGGACGACCCTGAACAGCTCGTCCCCGACGGAGCCATTGGAGAGTTACTT
ATTGAGGGACCCATTGTGGGCCAGGGCTATTTAAATGAGCCTCAGCGTACCTATCAAGCCTTCATTGAGGCCCCC
AGTTGGTTGCAGGCCATTCGCTCCCCCGGTACCATTCGGGTCTACAGAACTGGGGACCTGGTTCGGTTTGCAGCT
GACGGGTCACTCATCTTTGTCGGACGCATGGATGACCAGGTGAAGCTACACGGCCAGCGGTTAGAGCTGGGTGAG
GTTGAACATCACGTTCAGCAGGCTTTCGCTGCATCGCTTACGGTGATTGATCTCATCCAACCCAAAGAGGAGCAA
CAAATGGGTCCGTTCCTCGCAGCATGTATCTTCTCTCCCGGCCATGCTTGTAAATCACCATCTCATGCCGGCATT
TGGGAGCCCCCTTCAGACACCTTTCGAAAGAAAGTTCAAGAGGCTAGAACAGCATTGTATCAGAGCCTGCCTTCA
TACATGGTGCCTTCTGTGTTTCTGCCATTGGCATACCTGCCCAAATCAACGACAGGAAAAATTGATCGAAAGCGT
CTCCGCAATTACATCCTTGACATGTCCCAAGAGGAACTCATTACTTATAGCTCTCCCGATGTCAACTGGGTGGCC
TCTGTCTTAACCCTCATGGAGACGCGCTTGCAGGATCATATTTCCAGTATCCTGCATAAACAACCTTGGCAGGTT
TCACCCGATCAAGATCTCTTTCAGCTGGGAATGGATTCAGTGCTAGCCATGGCCCTAATTGCAAGGCTGTACAAG
GACGGCCTCAAGCTAACGGTCAGGGATATCTTTGAGCAACCTCAGCTGCGTAACCTGGCTCTTGTGGTGCGAGAG
ACGTTGCGGCCAGATCAAGAAGGTGTCAGGAAAGCACACAGCCGCAGCCCCCTTCTGCACTATGCGAAGGAGATT
GCTGATGAGTGGAAGATGGCTTTAACCTCCATTGAGCACATTTTGCCAACTACCCGTTTCCAGCGAGAGAGCTTG
GAGGCGCGACACAAAGTGTACTTTATTTTCCATTTTCATGGCAAGATCGACTGTCAGCGTCTTCAGCATGCTGTG
CAGGCTGCTGTAGACAAATACGCCATACTGCGAACGGTCTTCATTCCTTGGGACGAGTCTACAGTTCAAATAACT
TTAGGTGACGCCACTGTACCGGTGGAAATCACGACGACCGATCTGAATCCAGTAGAAATAGCAGGATCCATTTGC
CGCGAGGATTCATCAGCACCCGTTGCTCCCGGCAAACTACACACCCAGCTTCGCTTGATCATGGGGTCCAACCGT
GATTCAATGGCCCTTCGGTTGTCCCATGCTCAGTATGACGGCATCAGCATGCCTCGCCTGTTCACGGACATCGCC
CGGGCATATCAGGGGATAACTTTAAGTCCCGCTAAGGTGGACTTTCCGGAATACCTGCACAGCCGCATCTATAAT
ATTCCTTCGCAGGCATACAAGTTCTGGCGCGACTTGCTCCGAGGTTCCAGCATGACCTATCTACGTTCTGAATCT
TCATCAGGGTCTCCGCCTTCCCATAATCGGGGAAGCCTTATAACGAGCACCACAGAGGTCTCATACCCGCCAGCC
CCCGCTGGAACCACGATGGCCACCGTCGCCAAGGCAGCTTGGGCCCTCTGCCTGGCACACATGGCTGGCACTCAC
GACATCGTATTCGGTCAGCTCGTCAACGGCCGAAACCTGGAGCTGCCAGAGGCCGAAACGGTTGTGGGTGCCTGT
GTCAATTACGTCCCAGTCCGTGTGACTCTCCAGGCTGACTGGACCGTGTCAAGCCTCCTCCATGCGGTTCATCAG
CAGCAAACCCGCAGCATGGCCTTCGAGACACTCGAATATGACGAGCTGGTGGCGCAGTGTACCTCCTGGCCGGCA
GACACAGACCCGGGTACCGGGATCCACTACGTGAACATCCCCGATGCGTTTGCTGGTAGCGGCCTGCCTGGGGTG
GGGTCGGACTATGAGACCTATGTATCCCGCTTGCCTTATTATCATCCCCGTGTGACCTGTAGTCCCCTCTCGAAG
GGAATACTTGAGCTTACGCTTTCCGTCTCGGATCAGCTGTGGGATCAGAATCAGGCGGATCAGACTCTGCATCTG
TTTGGGCAGACTGTGGTACGCATTCTGGAGAACCCAACAGGGCTTGCTTGTGATGTTCTTAAAGCGCTGGTGTAG
Transcript >Ani_SJS100_1|g7361.t1
ATGGGAAGTATAGGAGACCTGCCCGTGGGGGTATTTCCCACGCTGGTACCCCCGAGCTCTAGTGGTCACACAGAA
TTCCATGCCTGGGAGATTTCCCCGGACATCCTCACAAATCTTCTGCAAAGCAGTATCCGAAAGGAAGTTGATCTG
ATAGTGCTGTTGCGTAGCATCTGGGCCATTGTTCTCCGCCAATATGTCGAGTCAGACGGGCTGTGCTTCAAGGCG
GGAAGCATGACTTCAGCTTGCTCTGAGTTGGATATGCTGGTCTATCGAGCTGGCATCTCTTCACATGACACCCCA
GAAGGTATCTGGAGACAGCAGCAAATAACGACCGGTATCAGTGCGGGAGGTCGGAACTGGGAGGTGAATACTGGT
GTCTTTCTACTCAAGCTGTGCAGTGATAGGCAATGGAGAGCCAGAGCAATGCAAGCTGTGGATGCTTGCTTGGTT
ATGGAAGAAGTGGATGCCAATGCTCCTCGTCTCTATTTCCTGGCGAAAGCGACATTATTATCCAGACAGCAGGCT
CAGTATGTTGCAGATACTGTCGCTCATGTCGCCTCAGAGATCCTGCGCAAGCCCAACCAGACACTCAGGGATACG
GATTTCTTTAGTCCCCAACATGCACCAATCCTACACAAGTGGAACCACCGTACCTTCTGGCCTGGCGAGGGCGAC
ACTCCCTCTTCCATCCTGGACGCCATTCGACGACATAGTCAGCGGAGCCCCGACGCGCTCGCTATTGTCGCTTGG
GATGGCAGTATTTCCTACGGAGATCTCGAGGCACGCAGCACGTGTCTGGCAGAGTATCTGCGTCGTGTCGGTGTT
GGCCCGGGTGTCATGGTGCCCCTGCTTCTAGGCCACAGCCAATGGGTCATCATCACCCAATTGGCCGTCCTCAAA
GCCGGAGCAGCCTTTGTACCCCTGGAGCCATCGCATCCACAGGAGAGATTGCGATATATAGTGCGCTGTGTGAAA
GCCTTCTTGATTGTGGCGTCCGAGGCGCATTGCGCTCGGGCTCAACAGCTGGTTGAGCAAGTCATCCCGATTAAC
GAGAACATCATGAATACAGTGCGTACCGCACTCCTGTCGACGGCGTACATAACTCCGACTGCAGACGCTCCGGCA
TATGTCCTTTTCACCTCGGGCAGTACCGGGCAGCCCAAAGGCTGTGTGATCGACCACCGTGCGATGGCCCAACTC
CCCCATGATGGTGTAGCAGCGTCAGTGGGACCTGACTCACGTGTGCTGCAATTTGCGACCTATAGCTTCACCATG
GCCATCTATGAGATATATTGGTGTTTGAGTAATGGCGGGACACTCTGTATCCCCTCAGACCATGACAGGTTGAAC
AATCTTCCTACCGTGATCGAGGAGATGCAAGTCACCTGGGCCGTGCTGACTCCGTCAGTACTGCGACGGCTGAGC
CACGATAACCCCCCATCTAGTTTGCAGACGCTTGCCCTAGGCGGAGAGCCGTTGGCTGCCGGGGATATGGAGGCC
TGGGTGCGAAAGCTGCAAGTGTTTTTCGGTTATGCGTCTAGTGAAGGGACGGCACTGAATTGCCTGACGGAGCTG
AGCGAGCAATCACATGCCTTAGAGTATACGCCTACCCCCCGGGTTCGTCACTGGATCGTTGATCCCGACAACCAT
GATAAACTCGCGGCAGTGGGCACAGTTGGGGAGTTGATCGTTGAGAGTCCCGGACTCGCCCGCGAATACCTGGAC
AATCCAACCGCTACTGCCGCCGCATTCATTCAAAGTCCCGACTGGAGAAGGTCATTTCGATTTTCCCAGGATGCG
AGCCAACCGATCCGTATGTATAAAACCGGAGACCTCTTCCGCTATACGGAAAGGGGCAACCTGCAGTACGTTGGC
CGGAAGGCCACGCAAGTCAAGATCCGCGGCCAACGTTTGGATCTGGGAGAAGTCGAATACAACGTCAGCCAACAG
TGTCCTGCACCCGCCCGAGTGATTGCAGAGACAGGGGTCCCGAGAGATGGGGCAGGGACAATGTTACTAGTCGCG
TTTCTTTATTCGGACAACTACACATTAGAGCAATCAGAAACGACGCAGTCAGATGAGGCCTCTCTATTTGCTGTC
CCCTCCGATCAGTTCCGCGCCGACATGAAGATTTTAACACAAGCATTAGAACCATTGTTACCGGCCCATATGCTT
CCTGGCATCTACATTCCTCTGCGACGCTTCCCATCGACGTTGACGGGCAAAGCCGACCGTCGTCTGTTACGCGAA
CTGATCCAGCAGCACACTCGTGGCGAGTTGGAGCGTTACCAGTCTGTGACGACTAATAATGTAGCGCCTCCAAGC
ACTCGCCTGGAGCGAGACCTTCACGGCCTTTTCGCCGAGGTACTGGGGATAAATGCTCAGGACTTCGGGATTAAT
CACAGCTTCATACGTCTGGGAGGAGATTCTCTCGCCGCGATGAAGCTGGTCAATTTGAGCCGTAAGCTAGGCCTG
CGCTTGACAGTCGCGCAGATTATGGAGAGCAAGACTGTTGCCAAGCTGAGCAACACAACGTTGGCCGACGAGTCT
TCTGTTAGCACGATAATCCCTCTGAGGGATGGCCCTCTCGAAGCCAAACTTCTGCTCGACTTTTGGGAAGGTATC
GAAGAAGAACACATCGAATCCATTTCCAACTGCTCCACCATCCAGCAGGGCATTCTATTGGGACACATTCGAAAC
CCAGCCCACTACCATAATCGAATAGTGTGGGAAGTCCTTGAGCCCCCTGCAGCACGAGATATCGATCGAATGCGC
CGTGCATGGGCGCACGTTTGCCGCCGTCACCCCATGCTACGTACCTTTTTCGTGGAAGCTCCAGCCGGAAACAGC
TCCCTGGCGCTTCAAATCACGCTGAAAGTGTCCCGCTTCCGCCCTGAGGATGTGGATGTGTTGTATGAGGAGCCT
GAACAAATGCCCAGCACGAATCCCACTCTAGCCTCTGAACAGCCCCTACAGTGGATTCCCCGATTACGAATCTAT
GAGGCTACCGGCAATCGGCTATACTGTGCAATCGATATTCATCATGTTCAGGTGGACATGATCTCCTTGGGGATA
ATTATCCGAGATCTGAGGCGTTGCTATCTGGATGAGACTGAGTATGTTGCAGCGGGCGACGTGTCTGAACCCAAC
AGTGTGTCATACACCGACTACACCCAGTATCTCGTTGCATCCCAGTCAGCGGAGAGTCTCAGTTACTGGAGAATT
CGCCTAGCTCATACGGAGCCGTGTATATTTCCCCGCCTGCAGCAGGGCCCGTTTGAGGCCGCTTCGTCAGCCCTT
TGCAGTGTAGAGCTCCCTCTGACGCCGATAGCTGACCATCTGCAGTCATTCTGCAAGGATACGGAAGTCACCGTG
GCCACGGTGTTCAAGCTTGCCTGGTCACTGGTGCTAAGCGCATATACTGGGTCTCGCTGTGCCTGTTATGGTTCG
GTGACGGCAATGAGAGATGTCCCTTTAGCGGGTGTCGAAGATCTGGTCGGGCCACTAATCAACACGCTGCCGTTT
TGTGTGGAATTGAACCCTGACGAAAGAGTGATGAATGTGCTTCGACGGGTCCAAAATCTATTCCTCGAAGAACTA
CCACACCGACAAGTATCCATTGCAGAACTTCAACATTCCCTAAATAATAGCAGCGGTACTCTCTTCAACACCACA
ATGAGCTTTGTCGACAGCTTAGACCCTGCAGCAGATTCCCAACACCCTATACGATTGGTCTCCTGGTACGGACCG
ACTGAATATGACCTCGTAGTTGAAGTAACTCCAGGGCCCCCCGTCTCGTGCTGCATCAGATACTGGAGCCATATG
ATGTCCGACTGGCAAGCATCCGCTCTCGCAGATACTCTAGCCATGTCGGTTTCGCAGATTCTACGTGGTGCATCT
TCAGGCCAGTCCGTCGGAAGCCTCGATCTATGTACGGCCCGAGATAAGCAGAAGCTCGTTGAATGGAATGGGTCT
CCCCCGGAGGCCGTGCGGGTGCGTGTGCACGATTTGATCAAGGCTCGATGCATCGAGCAGCCAGATGCCTTGGCG
GTGTGGGCCTGGGATGGTGCTTTGAGCTATCGGGAGCTCGACTGTCTTTCCTCGAATCTAGCTAGAAGGCTTATG
GCCCGTGGGGTCGGGCCTGAAGCGTTTGTCGGTATTTGTTTTGACCGGTGCAAATGGACGTTGGTATCGGTTCTA
GCTGTCGCCAAAGCTGGGGGTGCATTTTGCCTGATGGACTCGTCGCATCCGACATATCGCCTGCGCGAAATCTGT
GATGCCTTGGGAGCAAATTTAGTGATCACGACACCAAAACATGTCGCAAAGGTATCCAAATGCGAACGTCCCTTG
TTGGTAGTAGTGGAGGGTGTGTGTTCTGAAACAGACGATTTGCCAGGTGGATTGGGGTCCGAATATCGTGACACA
CTTCCTCGAAATGCCCTATATGCAGTCTTCACATCCGGCTCGACGGGAAAGCCCAAAGGCGTCGTTATCACACAC
GAGAATCTGGCTGCAACAATCAAAAATTGCCCTCAACGGTTGGACCTACGACCAGGCGATCGGTCTCTTCATTTT
GCGTCTTACGCCTTTGACTTCAGTATCATCGAGGTTATAGTTCCCATGGTAGTGGGGGCCTGCGTCTGCATTCCA
TCGGAGCATGACCGTTTGAATAATTTGCCCAAGGCCATGGCGGACCTTGCGGTAACCTGGGCGATTATGACCCCG
ACGGTGTCTCGGTTACTAGAACCTGCCAGCCTACCCACCCTTCGAACTTTAGTCCTTGGAGGAGAGGCAATCATG
CCTTATGATTTCACGACCTGGCAGGGTTACACGACCCTCATCAGCGCATATAGTCCGGCTGAATGCACGCCGATT
GGACTTTGCACTGTGGTTCAGGCGGATGATCCGAACTGTTTGGGCAAGCCATTCACTTCTATGTCGCCCTGGATC
GTTGACCCAGAAAATGTTCAGCGGTTGGTCCCGGTCGGTGCTGTAGGAGAGCTCGTCATAGAAGGGACCGTCGTC
GGTCGAGGCTATCTACACGATGCAGAGCACCGTGATATAGTCTCCTCACCGTTCATCCCTCCGACTCAGTGGCTA
TCCCAATATCGAACCATCGACGTGACTAACCCTTCGCGCTTATATCGCACCGGGGACCTTGTCCAATTTACTGAG
GACGGGGCGGTACGATTTATCGGGCGCAAGGACTTGCAGGTCAAGATCCGGGGCCAGCGACTGGAATTGGGCGAA
GTGGAATCTCGACTCCGAAGCTACCTCCCTTGGGCTGGCGCAATTGTCGTCGAAGCTGTTGTCTTGAAATCCCCC
GGTGGTCGCGCAGTACTGGTCGCCTTTATATCCATTAACTCCCCAGATGTTACAGACAACGCCGAGACAGTGTGC
GAGATAGCCGGATCGTTTGATAATGATGACAATAGTGTATATCAGCGTGATATCGATAAGGCTCTTTCACATCTT
GGGGATGAGCTACCGAACTGGATGGTCCCTTCGGTGGTTCTGAAGGTGCAGGGCATCCCAATGACCAAATCCGGA
AAAGTTGATCGACGCAGACTGCGACAACTAGCTACCCTGATTCCCCGAGAGACGCTAGGGGCCTCTAATGTCCAT
AGTTCTCTTCGTCAAGCTCCAGTCACCGAAGAAGAGAGACGGCTACAGATGGCTTTCGCGAACATCTTGCAAATG
CGGCCTGAGGAGATATTCGCTGACAGTCACTTTTTCCAACTTGGGGGTGATTCTGTTGGAGCCATGGAGCTGGTG
GCAGCGGCGAGGCTACAGAATATGGGAATCAGTGTCAGTGAGATTTTCCAGCATCCTACATTGAGTGAGCTGGCA
GCGGTGGCAACCAAGACCATGGATGAGGAGACTTCTGAGATTCCGCCCTTCAGCCTTCTACCCAGTGACTACGAA
TCGGATATCATCTCATCCGCTCTAGAGCAATGTGCTCTATCGCTGAATGACTTGGGTGATATCTATCCGTGTACC
GCCTTTCAGGAAGGGTTAATGGCCCTTGCCAGTCAAAAAGCTGGCAAGTACGTCTGTCAGTGTCTATTTGAGCTC
GGACGTGATGTTGAGATAAATAAATTGAAGACCGCGTGGCAAGCAACAGTGACTGCCAATGATATCCTCCGCACC
CGGATTATTCACGTTCACCCGCACGGTACCTTCCAGGTGGTCCTGACGCCAGCCGCAGCTCCGATTTTGTGGCAC
AGATATGAGACCGTCAATGAATGGCGCAAGAAGGATATGGAACTGAACATGGAACTGGGAACCACATTGGCTCGC
TTTAGCATCCTCAGCTCGGCCCAGGGACAGACACTCGTAGGTGTCTCTCTCCATCATGCCATTTACGATGGCGTC
TCCCTGCCCCGACTCTTTGACCAGGTGCAAAGGGCATATCAGAATGAACGTCTACCCCTCAATAAATTCACACCC
TTGATTCGCTCTCTAATCTTGCAGAATCCTAAGGATGTTGAAGAATTCTGGCGCACCGAGTTCCATGGTCTTCAG
ACTTCGGTATTCCCAGGTTTGCCCGAGCCTGGATTTGTGCCCAACCCTACAGCGAGCGTGGAAAAGGAGATCAGG
CTCCCACGGCCACCGCACCTGCCAAGTGTTACCCTTTCAACAGTAATGAGGCTGGCATGGGCACTGCTGGTATCA
TATTATACAGATTCTGAGGATGTGGTCTTTGGCGTCACCGTCAGTGGTCGAGCGCGGTCTGTTCCTGGGATAAAC
CTTCTAACTGGCCCTTCTATGGCCACTGTTCCATTCCGCACGCGAATTTGTCGTGATAGTCTACTTCTGGACGCT
CTGCGTGATGCTCAGGACCATTCCATGCGCATGATTCCCTTTGAGCAGGCAGGTCTGCAAAGGATCCGAGAGCTC
AGCGATGAAGCTAGCGTTGCCTGCGGATTTCAGTCACAGTTGGTCATTCAACATGGCGAGCATAGCCAGGCCTCC
CCTAACATGATGATACTGCGTGATCAGTTTGCGGATCATGCGGCGTTTCTCAACTACGCACTGGTTATATTGTGC
ACCCCATCAACGGCACATCAAACCGTACGCGTGAACTTTCAGTTCGATCCGCAAATTGTACTGCCGGCGGTCGCA
GATCGACTGCTGAGCCAATTTGCCCATATCGTGGATCAGATGTGTGCGCCATCTAGCTACAACGCTAGGCTCGGG
GGCCTCGAAACAATAACTCCCCAAGATTGGACCTCGCTGCGGCAATGGAACGGCAGCCTACCAGCCGCATACCCT
CATCCGCTTCATCATCTCGTACTGTCGCAGGCGGAGACCACACCCGACAGGCGGGCCGTGGAGTCATGGGATGGA
ACCTTGACATATGCTGAATTGAATGATCTCTCGGGAAAGCTAGGGCAGCATCTGTTGAACCGTGGACTGAAACAG
GGTTCACGGGTGGTTCTCCTTTTTGACCGCTCCCTCATATCGGTTGTGACAATGTTGGCAGTGCTTCGGTCAGGA
GGCATATGTGTCAACATTGACCCATCTCTACCGCAGACTCGCATTACCCAGACAATACACCAAGCACGGCCCTCA
GTGGCATTGGTATCATCTACATATCAGTCGCGGCTGGCAGATGCATTGCCGGTTCCTGTCCTCACGATTGCACTG
GATACCATACCACGAAGCGCAAAGAACATCCCTTGGCCACTTGTGCGCTCTACTGACCTTGCATTTATTCTCTTC
ACTTCCGGTACCACGGGAAAGCCCAAAGGCATCATGGTAGAACATGGAAATTGCGCTACCGACATTTTTCACTAC
AGTGCTATCTTGGCCGTCACCCCGGAAATAAGAACACTACATTTCTGTAGCTATGCATTTGACTTGAGTATCTAC
GAGGTTCTGACACCCTGGATGCACGGCGGATGTCTGTGCATCCCATCAGAGTCTGCACGGCTTTCAGATTTGCCC
GGAGTCATCCAGAAATACCACGTCAACTTCGCAATCCTGACTCCATCCGTGGGGAGTGCGCTACATCCAAGTGAC
CTTCCCAGCCTGCAAACCCTCATCCTGGGTGGTGAAGTGATGCCTGCGGTGATGTTCGACCGCTGGGCCTCTCAT
GTACGCTTGATCAACTTGTATGGCCCAGCAGAGGCCACCCAGTGTGCCGCTCTCCACCTGAAACCCACAGACGAG
TTTGTGCCAGGACTTATTGGTGCTATGGTTGGCGCCTCGGGCTGGGTCACGGTCCCTGGCAGTCCAAATTGCCTC
ACCCCCATTGGTGCGGTGGGCGAGCTCCTGATAGAAGGCCCAGCGGTAACTCGGGGCTATTTTGACGAAATGGAA
CAGACGCAAGCATCATATATCGATCCGCCAGCCTGGTTGCAGGAGTTTCGCGGGCCTGCTGAGCCTGGCCGCCTC
TTCTGCTCTGGAGACCTGGTGCAGTATGTACCTAACCGGCCAGGTTGGCTGCGCTACATTGGACGCAAGGATAAG
CAAGTCAAAATCCGTGCACAAAGGGTCGACCTGACGGAAGTCGAGCACCATGTCGATGAGCTACTCCCACCAGGC
AGTCAGGCAATTGCCGAGGTCCTGTTCCAGCACTCGTCTCCCCGCCAATCGAGCCAGCTTGCAGTATTCTTGGCC
TTTGGTGAACAGTTAACCAACAAAATGGACATCATATGCGCCCTCGATGAGCCATTCAGAAGATTAATAGCTGAA
ATCCACCCACAGCTTCAGAAAAGGCTCCCTTCTTACATGGTCCCCACCCTCTTCTTTCCGGTATCTCACGTTCCT
CAAACACCCACCGGTAAGACCGATCGAAATCGGTTGCGGCAGTTGGTAGAAGGGTGGACGACCGAACAGCTGCTG
CCATATCATCCGTTCAGTACAGATTCAGCGCGTGCGCCAGTAGAGACGGCTGAGGAGCGCATCTGGCAGCACATG
TGGTGCGAGGTACTCTGCATACGTCCCGAGAATATCGCCAGAACTAGTCATTTCTTTCACCTTGGCGGTGAGTCT
GTTAGAGCGATGAGGTTGGCCGGGTTGGCACAACGTGAGGGATGGATCATTTCCGTGCCAGATATTTTCGCTCAT
CCGACGCTATCGGAAATGGCGAGTCTCGCTGTACCCTCCCCCAAGGGTGTGCCGGTTCCATCTCCAGACCGTTTC
AGCCTGGTAGGAAGCGGAAGGCGGGCATCATATCTGGTTAATATGGCGACTCACCAGTGCAACGTCACCAAAAGT
GAGATAGAGGATATATATCCTTGTACCCCGCTCCAGGAGACTCTCATAGCCTCAACGGTACAAAAAGGAGGCTCC
TACCAAGCGCTGGAAGCCTTTGATCTGATAGCCGATGTGGATTTGGAACGCTTGGAAATGGCGTGGCAAAAGACA
GCGGCCGATCATGCTATCCTCCGCACGCGAATTATGCAAGACTATACCGGCGAACTGTTTCAGGTGGTAGTCAAA
GGTCCGTTAGCATGGACCGCGGAACAAGCGGACATAAACCCTGAGAATGGGTTACTGCATTTCCAGCGTACCATG
GGCATTGGGACACCCTTGATTCATCTAGTCCTTCTACAATCTCCCGGATCCACGATACCCGATCGTCTCTTGCTC
TCGATACATCACGCATTGTACGATGGATGGTCCCTGCCCCTGTTGCTCGAGGAGGTCAATCAGAAATACATCGGC
CCATATCGGGGCCAAGACACAACCGTGCCTTTCAACGAGTTGGAAACGAAGACAGAAGCTCGACTATTTCCACGT
TTGCCGGACGGGGCATACGAGCCACACCCACAGGCTATTTTGCAGGACCAAGTCTTTGTTAGCCCGACGCGGAAT
GAATCTGAGATAACCCTCGCAACCATGGTCCAGGCATCTTGGGCATTGACAGTGAGTTGCTACTTGAACGCAAGC
GATGTAGGGTTCGGGATCACCACCTCTGGACGAGCTGCCCCTGTTCCGGGAATCGATCGACTGTTGGGACCTACG
CTGGTTACATTGCCCCGACGCATACATATCCAGAACACCCTGGATATCAAACTTTTCCTACGGCAACTACAGCAG
CGCTTTACGGAGCAGTCCAAGTATGAACACATTGGACTGCAGCAGATTCGCCAGCTAGGGCCATCGGCGGCCAGC
GCGTGTCGCTTCCAGACTCTCCTAGTCATTCAGCCCGACCAGCCAAAGCGCCAGCTGGCTTGGGCTGGAAACCAC
CAGAGTGCGGCCGAATTGACGCAGTTTAGCAATGTTGCGTTAACCCTGATCTGCCAGCTCCCCTCTCCCTCCTCG
ACGTCCATTGGCCTGACAGCAGTTTACGACCCTCGAGTACTGGCACCCGCACAGATGCAGCGGGTTCTGTCGCAA
GTTGGCCATGTCTTCAGAGAGTTACAGGATGCTCCAGACGGTGTTCCCATCGCCTCGCTCAATATGCTGAACCCC
AGTGACTCCGCAGAACTGCAACAGTGGAATAAGCTCACTGTTCCTACTGGAAAGCATCAAGATCAAGAATTTGTG
CATGACATGATACGGCGGCAATGCCAGCTTCAACCAGACGCCGTAGCCGTTGAGGCATGGGACGGAAGCCTCACT
TATGAAGAGCTGGATTCCTACACGGAGTACCTGGCTGCGAAACTGCAGCTATGTGGTGTTCGCAACGACCACTTC
ATTGCTCTCTACTTCGAGAAGTCATGTTGGACCATTGTCGCCCAACTGGCGGTCCTGAAAGCCGGAGGGGCCCTA
GTGATGCTAGAGCCTTCTCATCCCGTTGATCGCCGTCGGGAGATTTGCCAGACTTTGGATGTCATGTTAATCCTT
GGTCCTCCTCACCTCACTCATTCGTTGGAACAGGAGCTCAATATCAAGGTACTACCTATCAGCAAGGCTCATCTC
AAAGCGTCGGATGGGGAACATCTATCAGTCGACAGTCATATACAGTCTCATAACCTCATGTATGCCATCGCTACA
TCCGGGACTACTGGTTGTCCTAAGCTCGCATTGGTTCATCATGGCGGTTTTGTTGCCACTGCAAGGACCTTGGTT
GATAGGCTCCTCTTACTGGCATCGTCTCGGGTGCTTCAATTCTCTAGTTACGGATTCGACGCAAGCTTAGTGGAA
CAACTGCTTCCGTTAATTGTAGGAGGCTGCGTCTGTGTTCCCACCCCCTTTGACCGTGATAACCGCCTAGCGTTC
ACGATGGCGACCATGAAGATCAATTGGATGGTTGCACCAGCATCAGTGATTCACCTACTTTCACCTGATACGGTC
CCAACACTACAGACATTAATATCTGCGGGTGAGCCATTGCAGCAAAGTATAATCGATGTGTGGGCCACTCGAGTC
AACCTCATAAATGCATACGGCCCAGCAGAGTGCAGTATGGTGTGCTCGGTCAACCCAAGCGTAAGGCCGGGAACC
GATCCGAACAATATCGGATACCCAATTGGTGGCACCTGTTGGATAGTAGACCCAAATGATATCAACACCCTTTTG
CCAATTGGTGCTGAAGGAGAACTCCTGGTGGAAGGGCCGAACGTCGGTGTCGGATATGCGAAAGACCCTCGGCGC
ACAAGAGTTGCATTTTCATCATCACCGCCTCACTGGCTCCGCTCCATTCACGGAGAATCAGTCCACACTCGAATA
TACCGCACAGGAGATATCGCTCGATATAATCCCGACGGATCTGTGCTTTACGTGGGCCGTAAGGATTCACAAATC
AAATTACATGGGCAGCGGATCGAGCTCGCCGAGGTGGAACATCATGTCAGGCTATGTTTCCCAGGCGCCATCCAG
GTAGTTGTTGAGATGGTCAAGTTTGACGATTTTGAAACTAGCTCCCTCGTTGCCCTCATCGTCGTGTCTGGCTCA
GGCTTTCCAGCGTCTGGATCAAACATCCTGCTCCCAACAACCGCAAATTTCCTCAACAATGTTCAACACGCGGAA
GCACTCCTGCAGGATCGTATCCCACCCTATATGATCCCGACGCTGTTCGTACCGGTGGCACAGATTCCCTTCAAT
ACCAATGGCAAGGCAGATCGTGCTCGTCTGAGAACCTCGGTTGCTTCTCTGTCCATCCATGATCGTATAGGCTAT
CGCTCCACGGCCACAACAAAGCCTAACACAGATCTAGAAATTGTGCTTCATGGAATCTGGTCCCGTGTTTTGCGG
ATCTCACCTCAGAAGCTTGGCATCCATGAAAGCTTCTTTCGGGTAGGCGGCAATTCTATTAGCAGTATGCAACTA
GCGGCGCAGTGCAACGAGGCTGGCCTTCCAATATCCATCCAGGATATCTTCCGTTGCCGAACAATTTCGCGGTTG
GCGTCATCATTCAAGGGTCATCCTGTCCAGGCGGACAGATCTTTAGAAGCACATAGCCAGGATGGATCACTGGGC
CCAGTGCAGCGGCTGCTGCCTGAAGTAGGGCACCCCAAGGCTCCAGTGGATTCTACTCTTGCCGCCTTCACTGAT
GGCCAGTTCGAGGAGATAAATAACGGCATCCCGGCTGGATATGAAGGGCAGATACAAGATATCTACCCCTGCTCC
CATGCACAGCAGGGCATGCTCATCAGCAACACACGCAACTCCAGCCTCTATCAGCAAGTCTATCGCTTTGAAGTG
GTTAGAGGTTGTGATGCGCCCAACGTTGACTGTCAGCAGTTGGTAAGGGCGTGGCATGCGGTAGTCAAGCGACAT
GGAGCCCTGCGGACCGTTTTCCTTGATATACCAGGGAGAGGGTTCCACCAGATCGTGCTCGTCAATGCAATAGAC
AATGTCATAATTGCGGCTGACGGCAACCATAGCAGTACATGTACCCAAAAGAGACCTGGTACACAAGACCTGTAT
GGTCCTTTACCAACTCTAATTATTCACCAGGAGTATGATGAGCGGCTTTGGATCGAACTGCATATAAGTCATGCT
CTTCTAGATGGAGTGTCACTGCGAATCATCGAACAAGACCTCGTGAAAGCATACTACAACAACCTACCCTCTTCA
TTACCTGACTATCGGGATTACGTCACCTATCTGCGGGCAAAAGGAGATACGGAAATGTCATTGAGCTACTGGAAA
AAATACCTGGAGGGTGCGCAGCCCTGCCTCTTTCCACGCCTCCGTGACTCTACAGCAGCAGTGACAGACGTGTCG
GAGCCAAAGGCGACAGTCGACTTCGTGTCGCTTGACTTGGGCCCTCCGAAGTCTCTTGATCAGTTGTGTGAGACT
CATTGCCTGAGCCTTACCGCTATCTTGCATGTAGTTTGGGCCATTGTGCTGCAGCAATATACCGGAACGGACAGC
GTGTGCTTTGGATATGCCACATCCGCGCGGCATGTCCCCATCCCTCATGTGGATGAAATAGTTGGTCCAATGATC
AACACGCTGCCCAGTCAAATCCAACTCTCTAGGGATTCATCAGTACTGTCCACTTTACAAAAGTACACCGTTCAC
TTCATGTCCTGCATGGAGCATGCCTACGTCTCACTTGGACAGATATTACACTCGGCTATGTCCAGTACACAATCA
CCCTTCAACACAATGATAACTATTGTTGAGACTGGAGATCGTAGAGACGACGCTGATGGATCCTGCTTATCGTTG
GTTTGTATGGATGGACATGGGGAGACAGAGTATGCGTTGGCCTTGACTGTTTCCAAAGCATCGAGCCGCATGGAT
TTGCACCTTTCATACCAAACATCCATGGTCAATGCTTCTCAGGCCCATGATGTGTGCCTGATGTTTCAAAAAGTC
CTGTGTGAGGTCTTGGAGTGGCCCACGGCCAAGATTGGTGCCATTGATGCCCTGAATATGGGTCAGAGACAGCGC
ATGGAATCGAGGCAGCCTACCCCACCGGCTGCTGCAAATACATTGATATACGAAACCATCAATCGGCGATGTGCA
GAGCAACCATCCTCATCAGCCGTCTGTGCCTGGGATGGTGAATTTACCTACGGGGAAATTGATCAGCTCTCATCA
GTATTGGCGGGAGAGATCCTTGCCCATGGAGTTAAACCGGAGGACCCGGTTTTGGTATGCCTTGAAAAGAGCCGC
TGGGTTCCGGTGGTTATGCTGGCAGTCTGGAAAGCCGGGGCATGCTTAATTCTTCTGGATGCCACCCATCCAACT
ACCCGATTGCATATGATTGCCAAGCAATCTGCCGCATCACTGGCAATTGCAAATAGAAGTACGCGCTCCAAAGCA
AACATCCTGTGCTCACGAGTATTGCAAGTCGATGATGACCGCTTGTGGACTCGACATGTTAACTCCTCGCGGGCC
GAGATGGTTCATGTTGACGGACACAGCGCTGCATACATTATATTCACATCTGGCTCGACTGGAACACCCAAAGGG
GCTGTGATTGAACATGCTTCCCTTTCCATTGCGTGGGAGACCCTCATTACTCGACTACAGTTAAACCCGACATCG
CGTGTTCTACAGTTTGCCTCCCATTCCTGGGATGCGGCAATCATCGATGTTATGGCCGCATTGATGTCAGGAGGC
TGTCTCTGTGTACCCTCGGAAAACGAACGTATGGGGCATTTGGCCTTAGCTGCGAATCGTATGCGAGCCAATTGG
ATGCTACTGACCCCAACTGTCGCCCGTCAGCTTACTCCTAGCGAGTTTCTTTACCTCGAAACGCTAGTCCTTGGC
GGCGAACGGGTCAATACAACGGACATTGAAGTCTGGCATGATAAAGTCTGTCTCCTGAGCGCATATGGCCCAGCA
GAGTGCACGCAAATCACGAGCGTGACGAGGCCGTTAGATATGACCTGTGATGCGCGGAACATCGGCGTCCCAAAT
GCCAGCGCTGGATGGGTTGTACGTCCGGACGACCCTGAACAGCTCGTCCCCGACGGAGCCATTGGAGAGTTACTT
ATTGAGGGACCCATTGTGGGCCAGGGCTATTTAAATGAGCCTCAGCGTACCTATCAAGCCTTCATTGAGGCCCCC
AGTTGGTTGCAGGCCATTCGCTCCCCCGGTACCATTCGGGTCTACAGAACTGGGGACCTGGTTCGGTTTGCAGCT
GACGGGTCACTCATCTTTGTCGGACGCATGGATGACCAGGTGAAGCTACACGGCCAGCGGTTAGAGCTGGGTGAG
GTTGAACATCACGTTCAGCAGGCTTTCGCTGCATCGCTTACGGTGATTGATCTCATCCAACCCAAAGAGGAGCAA
CAAATGGGTCCGTTCCTCGCAGCATGTATCTTCTCTCCCGGCCATGCTTGTAAATCACCATCTCATGCCGGCATT
TGGGAGCCCCCTTCAGACACCTTTCGAAAGAAAGTTCAAGAGGCTAGAACAGCATTGTATCAGAGCCTGCCTTCA
TACATGGTGCCTTCTGTGTTTCTGCCATTGGCATACCTGCCCAAATCAACGACAGGAAAAATTGATCGAAAGCGT
CTCCGCAATTACATCCTTGACATGTCCCAAGAGGAACTCATTACTTATAGCTCTCCCGATGTCAACTGGGTGGCC
TCTGTCTTAACCCTCATGGAGACGCGCTTGCAGGATCATATTTCCAGTATCCTGCATAAACAACCTTGGCAGGTT
TCACCCGATCAAGATCTCTTTCAGCTGGGAATGGATTCAGTGCTAGCCATGGCCCTAATTGCAAGGCTGTACAAG
GACGGCCTCAAGCTAACGGTCAGGGATATCTTTGAGCAACCTCAGCTGCGTAACCTGGCTCTTGTGGTGCGAGAG
ACGTTGCGGCCAGATCAAGAAGGTGTCAGGAAAGCACACAGCCGCAGCCCCCTTCTGCACTATGCGAAGGAGATT
GCTGATGAGTGGAAGATGGCTTTAACCTCCATTGAGCACATTTTGCCAACTACCCGTTTCCAGCGAGAGAGCTTG
GAGGCGCGACACAAAGTGTACTTTATTTTCCATTTTCATGGCAAGATCGACTGTCAGCGTCTTCAGCATGCTGTG
CAGGCTGCTGTAGACAAATACGCCATACTGCGAACGGTCTTCATTCCTTGGGACGAGTCTACAGTTCAAATAACT
TTAGGTGACGCCACTGTACCGGTGGAAATCACGACGACCGATCTGAATCCAGTAGAAATAGCAGGATCCATTTGC
CGCGAGGATTCATCAGCACCCGTTGCTCCCGGCAAACTACACACCCAGCTTCGCTTGATCATGGGGTCCAACCGT
GATTCAATGGCCCTTCGGTTGTCCCATGCTCAGTATGACGGCATCAGCATGCCTCGCCTGTTCACGGACATCGCC
CGGGCATATCAGGGGATAACTTTAAGTCCCGCTAAGGTGGACTTTCCGGAATACCTGCACAGCCGCATCTATAAT
ATTCCTTCGCAGGCATACAAGTTCTGGCGCGACTTGCTCCGAGGTTCCAGCATGACCTATCTACGTTCTGAATCT
TCATCAGGGTCTCCGCCTTCCCATAATCGGGGAAGCCTTATAACGAGCACCACAGAGGTCTCATACCCGCCAGCC
CCCGCTGGAACCACGATGGCCACCGTCGCCAAGGCAGCTTGGGCCCTCTGCCTGGCACACATGGCTGGCACTCAC
GACATCGTATTCGGTCAGCTCGTCAACGGCCGAAACCTGGAGCTGCCAGAGGCCGAAACGGTTGTGGGTGCCTGT
GTCAATTACGTCCCAGTCCGTGTGACTCTCCAGGCTGACTGGACCGTGTCAAGCCTCCTCCATGCGGTTCATCAG
CAGCAAACCCGCAGCATGGCCTTCGAGACACTCGAATATGACGAGCTGGTGGCGCAGTGTACCTCCTGGCCGGCA
GACACAGACCCGGGTACCGGGATCCACTACGTGAACATCCCCGATGCGTTTGCTGGTAGCGGCCTGCCTGGGGTG
GGGTCGGACTATGAGACCTATGTATCCCGCTTGCCTTATTATCATCCCCGTGTGACCTGTAGTCCCCTCTCGAAG
GGAATACTTGAGCTTACGCTTTCCGTCTCGGATCAGCTGTGGGATCAGAATCAGGCGGATCAGACTCTGCATCTG
TTTGGGCAGACTGTGGTACGCATTCTGGAGAACCCAACAGGGCTTGCTTGTGATGTTCTTAAAGCGCTGGTGTAG
Gene >Ani_SJS100_1|g7361.t1
ATGGGAAGTATAGGAGACCTGCCCGTGGGGGTATTTCCCACGCTGGTACCCCCGAGCTCTAGTGGTCACACAGAA
TTCCATGCCTGGGAGATTTCCCCGGACATCCTCACAAATCTTCTGCAAAGCAGTATCCGAAAGGAAGTTGATCTG
ATAGTGCTGTTGCGTAGCATCTGGGCCATTGTTCTCCGCCAATATGTCGAGTCAGACGGGCTGTGCTTCAAGGCG
GGAAGCATGACTTCAGCTTGCTCTGAGTTGGATATGCTGGTCTATCGAGCTGGCATCTCTTCACATGACACCCCA
GAAGGTATCTGGAGACAGCAGCAAATAACGACCGGTATCAGTGCGGGAGGTCGGAACTGGGAGGTGAATACTGGT
GTCTTTCTACTCAAGCTGTGCAGTGATAGGCAATGGAGAGCCAGAGCAATGGTAAGTGGCTGACGGGCGCATTGC
AGAATATGATTATGGATGCTAACATCGTGAGAGTTGCAGCAAGCTGTGGATGCTTGCTTGGTTATGGAAGAAGTG
GATGCCAATGCTCCTCGTCTCTATTTCCTGGCGAAAGCGACATTATTATCCAGACAGCAGGCTCAGTATGTTGCA
GATACTGTCGCTCATGTCGCCTCAGAGATCCTGCGCAAGCCCAACCAGACACTCAGGGATACGGATTTCTTTAGT
CCCCAACATGCACCAATCCTACACAAGTGGAACCACCGTACCTTCTGGCCTGGCGAGGGCGACACTCCCTCTTCC
ATCCTGGACGCCATTCGACGACATAGTCAGCGGAGCCCCGACGCGCTCGCTATTGTCGCTTGGGATGGCAGTATT
TCCTACGGAGATCTCGAGGCACGCAGCACGTGTCTGGCAGAGTATCTGCGTCGTGTCGGTGTTGGCCCGGGTGTC
ATGGTGCCCCTGCTTCTAGGCCACAGCCAATGGGTCATCATCACCCAATTGGCCGTCCTCAAAGCCGGAGCAGCC
TTTGTACCCCTGGAGCCATCGCATCCACAGGAGAGATTGCGATATATAGTGCGCTGTGTGAAAGCCTTCTTGATT
GTGGCGTCCGAGGCGCATTGCGCTCGGGCTCAACAGCTGGTTGAGCAAGTCATCCCGATTAACGAGAACATCATG
AATACAGTGCGTACCGCACTCCTGTCGACGGCGTACATAACTCCGACTGCAGACGCTCCGGCATATGTCCTTTTC
ACCTCGGGCAGTACCGGGCAGCCCAAAGGCTGTGTGATCGACCACCGTGCGATGGCCCAACTCCCCCATGATGGT
GTAGCAGCGTCAGTGGGACCTGACTCACGTGTGCTGCAATTTGCGACCTATAGCTTCACCATGGCCATCTATGAG
ATATATTGGTGTTTGAGTAATGGCGGGACACTCTGTATCCCCTCAGACCATGACAGGTTGAACAATCTTCCTACC
GTGATCGAGGAGATGCAAGTCACCTGGGCCGTGCTGACTCCGTCAGTACTGCGACGGCTGAGCCACGATAACCCC
CCATCTAGTTTGCAGACGCTTGCCCTAGGCGGAGAGCCGTTGGCTGCCGGGGATATGGAGGCCTGGGTGCGAAAG
CTGCAAGTGTTTTTCGGTTATGCGTCTAGTGAAGGGACGGCACTGAATTGCCTGACGGAGCTGAGCGAGCAATCA
CATGCCTTAGAGTATACGCCTACCCCCCGGGTTCGTCACTGGATCGTTGATCCCGACAACCATGATAAACTCGCG
GCAGTGGGCACAGTTGGGGAGTTGATCGTTGAGAGTCCCGGACTCGCCCGCGAATACCTGGACAATCCAACCGCT
ACTGCCGCCGCATTCATTCAAAGTCCCGACTGGAGAAGGTCATTTCGATTTTCCCAGGATGCGAGCCAACCGATC
CGTATGTATAAAACCGGAGACCTCTTCCGCTATACGGAAAGGGGCAACCTGCAGTACGTTGGCCGGAAGGCCACG
CAAGTCAAGATCCGCGGCCAACGTTTGGATCTGGGAGAAGTCGAATACAACGTCAGCCAACAGTGTCCTGCACCC
GCCCGAGTGATTGCAGAGACAGGGGTCCCGAGAGATGGGGCAGGGACAATGTTACTAGTCGCGTTTCTTTATTCG
GACAACTACACATTAGAGCAATCAGAAACGACGCAGTCAGATGAGGCCTCTCTATTTGCTGTCCCCTCCGATCAG
TTCCGCGCCGACATGAAGATTTTAACACAAGCATTAGAACCATTGTTACCGGCCCATATGCTTCCTGGCATCTAC
ATTCCTCTGCGACGCTTCCCATCGACGTTGACGGGCAAAGCCGACCGTCGTCTGTTACGCGAACTGATCCAGCAG
CACACTCGTGGCGAGTTGGAGCGTTACCAGTCTGTGACGACTAATAATGTAGCGCCTCCAAGCACTCGCCTGGAG
CGAGACCTTCACGGCCTTTTCGCCGAGGTACTGGGGATAAATGCTCAGGACTTCGGGATTAATCACAGCTTCATA
CGTCTGGGAGGAGATTCTCTCGCCGCGATGAAGCTGGTCAATTTGAGCCGTAAGCTAGGCCTGCGCTTGACAGTC
GCGCAGATTATGGAGAGCAAGACTGTTGCCAAGCTGAGCAACACAACGTTGGCCGACGAGTCTTCTGTTAGCACG
ATAATCCCTCTGAGGGATGGCCCTCTCGAAGCCAAACTTCTGCTCGACTTTTGGGAAGGTATCGAAGAAGAACAC
ATCGAATCCATTTCCAACTGCTCCACCATCCAGCAGGGCATTCTATTGGGACACATTCGAAACCCAGCCCACTAC
CATAATCGAATAGTGTGGGAAGTCCTTGAGCCCCCTGCAGCACGAGATATCGATCGAATGCGCCGTGCATGGGCG
CACGTTTGCCGCCGTCACCCCATGCTACGTACCTTTTTCGTGGAAGCTCCAGCCGGAAACAGCTCCCTGGCGCTT
CAAATCACGCTGAAAGTGTCCCGCTTCCGCCCTGAGGATGTGGATGTGTTGTATGAGGAGCCTGAACAAATGCCC
AGCACGAATCCCACTCTAGCCTCTGAACAGCCCCTACAGTGGATTCCCCGATTACGAATCTATGAGGCTACCGGC
AATCGGCTATACTGTGCAATCGATATTCATCATGTTCAGGTGGACATGATCTCCTTGGGGATAATTATCCGAGAT
CTGAGGCGTTGCTATCTGGATGAGACTGAGTATGTTGCAGCGGGCGACGTGTCTGAACCCAACAGTGTGTCATAC
ACCGACTACACCCAGTATCTCGTTGCATCCCAGTCAGCGGAGAGTCTCAGTTACTGGAGAATTCGCCTAGCTCAT
ACGGAGCCGTGTATATTTCCCCGCCTGCAGCAGGGCCCGTTTGAGGCCGCTTCGTCAGCCCTTTGCAGTGTAGAG
CTCCCTCTGACGCCGATAGCTGACCATCTGCAGTCATTCTGCAAGGATACGGAAGTCACCGTGGCCACGGTGTTC
AAGCTTGCCTGGTCACTGGTGCTAAGCGCATATACTGGGTCTCGCTGTGCCTGTTATGGTTCGGTGACGGCAATG
AGAGATGTCCCTTTAGCGGGTGTCGAAGATCTGGTCGGGCCACTAATCAACACGCTGCCGTTTTGTGTGGAATTG
AACCCTGACGAAAGAGTGATGAATGTGCTTCGACGGGTCCAAAATCTATTCCTCGAAGAACTACCACACCGACAA
GTATCCATTGCAGAACTTCAACATTCCCTAAATAATAGCAGCGGTACTCTCTTCAACACCACAATGAGCTTTGTC
GACAGCTTAGACCCTGCAGCAGATTCCCAACACCCTATACGATTGGTCTCCTGGTACGGACCGACTGAATATGAC
CTCGTAGTTGAAGTAACTCCAGGGCCCCCCGTCTCGTGCTGCATCAGATACTGGAGCCATATGATGTCCGACTGG
CAAGCATCCGCTCTCGCAGATACTCTAGCCATGTCGGTTTCGCAGATTCTACGTGGTGCATCTTCAGGCCAGTCC
GTCGGAAGCCTCGATCTATGTACGGCCCGAGATAAGCAGAAGCTCGTTGAATGGAATGGGTCTCCCCCGGAGGCC
GTGCGGGTGCGTGTGCACGATTTGATCAAGGCTCGATGCATCGAGCAGCCAGATGCCTTGGCGGTGTGGGCCTGG
GATGGTGCTTTGAGCTATCGGGAGCTCGACTGTCTTTCCTCGAATCTAGCTAGAAGGCTTATGGCCCGTGGGGTC
GGGCCTGAAGCGTTTGTCGGTATTTGTTTTGACCGGTGCAAATGGACGTTGGTATCGGTTCTAGCTGTCGCCAAA
GCTGGGGGTGCATTTTGCCTGATGGACTCGTCGCATCCGACATATCGCCTGCGCGAAATCTGTGATGCCTTGGGA
GCAAATTTAGTGATCACGACACCAAAACATGTCGCAAAGGTATCCAAATGCGAACGTCCCTTGTTGGTAGTAGTG
GAGGGTGTGTGTTCTGAAACAGACGATTTGCCAGGTGGATTGGGGTCCGAATATCGTGACACACTTCCTCGAAAT
GCCCTATATGCAGTCTTCACATCCGGCTCGACGGGAAAGCCCAAAGGCGTCGTTATCACACACGAGAATCTGGCT
GCAACAATCAAAAATTGCCCTCAACGGTTGGACCTACGACCAGGCGATCGGTCTCTTCATTTTGCGTCTTACGCC
TTTGACTTCAGTATCATCGAGGTTATAGTTCCCATGGTAGTGGGGGCCTGCGTCTGCATTCCATCGGAGCATGAC
CGTTTGAATAATTTGCCCAAGGCCATGGCGGACCTTGCGGTAACCTGGGCGATTATGACCCCGACGGTGTCTCGG
TTACTAGAACCTGCCAGCCTACCCACCCTTCGAACTTTAGTCCTTGGAGGAGAGGCAATCATGCCTTATGATTTC
ACGACCTGGCAGGGTTACACGACCCTCATCAGCGCATATAGTCCGGCTGAATGCACGCCGATTGGACTTTGCACT
GTGGTTCAGGCGGATGATCCGAACTGTTTGGGCAAGCCATTCACTTCTATGTCGCCCTGGATCGTTGACCCAGAA
AATGTTCAGCGGTTGGTCCCGGTCGGTGCTGTAGGAGAGCTCGTCATAGAAGGGACCGTCGTCGGTCGAGGCTAT
CTACACGATGCAGAGCACCGTGATATAGTCTCCTCACCGTTCATCCCTCCGACTCAGTGGCTATCCCAATATCGA
ACCATCGACGTGACTAACCCTTCGCGCTTATATCGCACCGGGGACCTTGTCCAATTTACTGAGGACGGGGCGGTA
CGATTTATCGGGCGCAAGGACTTGCAGGTCAAGATCCGGGGCCAGCGACTGGAATTGGGCGAAGTGGAATCTCGA
CTCCGAAGCTACCTCCCTTGGGCTGGCGCAATTGTCGTCGAAGCTGTTGTCTTGAAATCCCCCGGTGGTCGCGCA
GTACTGGTCGCCTTTATATCCATTAACTCCCCAGATGTTACAGACAACGCCGAGACAGTGTGCGAGATAGCCGGA
TCGTTTGATAATGATGACAATAGTGTATATCAGCGTGATATCGATAAGGCTCTTTCACATCTTGGGGATGAGCTA
CCGAACTGGATGGTCCCTTCGGTGGTTCTGAAGGTGCAGGGCATCCCAATGACCAAATCCGGAAAAGTTGATCGA
CGCAGACTGCGACAACTAGCTACCCTGATTCCCCGAGAGACGCTAGGGGCCTCTAATGTCCATAGTTCTCTTCGT
CAAGCTCCAGTCACCGAAGAAGAGAGACGGCTACAGATGGCTTTCGCGAACATCTTGCAAATGCGGCCTGAGGAG
ATATTCGCTGACAGTCACTTTTTCCAACTTGGGGGTGATTCTGTTGGAGCCATGGAGCTGGTGGCAGCGGCGAGG
CTACAGAATATGGGAATCAGTGTCAGTGAGATTTTCCAGCATCCTACATTGAGTGAGCTGGCAGCGGTGGCAACC
AAGACCATGGATGAGGAGACTTCTGAGATTCCGCCCTTCAGCCTTCTACCCAGTGACTACGAATCGGATATCATC
TCATCCGCTCTAGAGCAATGTGCTCTATCGCTGAATGACTTGGGTGATATCTATCCGTGTACCGCCTTTCAGGAA
GGGTTAATGGCCCTTGCCAGTCAAAAAGCTGGCAAGTACGTCTGTCAGTGTCTATTTGAGCTCGGACGTGATGTT
GAGATAAATAAATTGAAGACCGCGTGGCAAGCAACAGTGACTGCCAATGATATCCTCCGCACCCGGATTATTCAC
GTTCACCCGCACGGTACCTTCCAGGTGGTCCTGACGCCAGCCGCAGCTCCGATTTTGTGGCACAGATATGAGACC
GTCAATGAATGGCGCAAGAAGGATATGGAACTGAACATGGAACTGGGAACCACATTGGCTCGCTTTAGCATCCTC
AGCTCGGCCCAGGGACAGACACTCGTAGGTGTCTCTCTCCATCATGCCATTTACGATGGCGTCTCCCTGCCCCGA
CTCTTTGACCAGGTGCAAAGGGCATATCAGAATGAACGTCTACCCCTCAATAAATTCACACCCTTGATTCGCTCT
CTAATCTTGCAGAATCCTAAGGATGTTGAAGAATTCTGGCGCACCGAGTTCCATGGTCTTCAGACTTCGGTATTC
CCAGGTTTGCCCGAGCCTGGATTTGTGCCCAACCCTACAGCGAGCGTGGAAAAGGAGATCAGGCTCCCACGGCCA
CCGCACCTGCCAAGTGTTACCCTTTCAACAGTAATGAGGCTGGCATGGGCACTGCTGGTATCATATTATACAGAT
TCTGAGGATGTGGTCTTTGGCGTCACCGTCAGTGGTCGAGCGCGGTCTGTTCCTGGGATAAACCTTCTAACTGGC
CCTTCTATGGCCACTGTTCCATTCCGCACGCGAATTTGTCGTGATAGTCTACTTCTGGACGCTCTGCGTGATGCT
CAGGACCATTCCATGCGCATGATTCCCTTTGAGCAGGCAGGTCTGCAAAGGATCCGAGAGCTCAGCGATGAAGCT
AGCGTTGCCTGCGGATTTCAGTCACAGTTGGTCATTCAACATGGCGAGCATAGCCAGGCCTCCCCTAACATGATG
ATACTGCGTGATCAGTTTGCGGATCATGCGGCGTTTCTCAACTACGCACTGGTTATATTGTGCACCCCATCAACG
GCACATCAAACCGTACGCGTGAACTTTCAGTTCGATCCGCAAATTGTACTGCCGGCGGTCGCAGATCGACTGCTG
AGCCAATTTGCCCATATCGTGGATCAGATGTGTGCGCCATCTAGCTACAACGCTAGGCTCGGGGGCCTCGAAACA
ATAACTCCCCAAGATTGGACCTCGCTGCGGCAATGGAACGGCAGCCTACCAGCCGCATACCCTCATCCGCTTCAT
CATCTCGTACTGTCGCAGGCGGAGACCACACCCGACAGGCGGGCCGTGGAGTCATGGGATGGAACCTTGACATAT
GCTGAATTGAATGATCTCTCGGGAAAGCTAGGGCAGCATCTGTTGAACCGTGGACTGAAACAGGGTTCACGGGTG
GTTCTCCTTTTTGACCGCTCCCTCATATCGGTTGTGACAATGTTGGCAGTGCTTCGGTCAGGAGGCATATGTGTC
AACATTGACCCATCTCTACCGCAGACTCGCATTACCCAGACAATACACCAAGCACGGCCCTCAGTGGCATTGGTA
TCATCTACATATCAGTCGCGGCTGGCAGATGCATTGCCGGTTCCTGTCCTCACGATTGCACTGGATACCATACCA
CGAAGCGCAAAGAACATCCCTTGGCCACTTGTGCGCTCTACTGACCTTGCATTTATTCTCTTCACTTCCGGTACC
ACGGGAAAGCCCAAAGGCATCATGGTAGAACATGGAAATTGCGCTACCGACATTTTTCACTACAGTGCTATCTTG
GCCGTCACCCCGGAAATAAGAACACTACATTTCTGTAGCTATGCATTTGACTTGAGTATCTACGAGGTTCTGACA
CCCTGGATGCACGGCGGATGTCTGTGCATCCCATCAGAGTCTGCACGGCTTTCAGATTTGCCCGGAGTCATCCAG
AAATACCACGTCAACTTCGCAATCCTGACTCCATCCGTGGGGAGTGCGCTACATCCAAGTGACCTTCCCAGCCTG
CAAACCCTCATCCTGGGTGGTGAAGTGATGCCTGCGGTGATGTTCGACCGCTGGGCCTCTCATGTACGCTTGATC
AACTTGTATGGCCCAGCAGAGGCCACCCAGTGTGCCGCTCTCCACCTGAAACCCACAGACGAGTTTGTGCCAGGA
CTTATTGGTGCTATGGTTGGCGCCTCGGGCTGGGTCACGGTCCCTGGCAGTCCAAATTGCCTCACCCCCATTGGT
GCGGTGGGCGAGCTCCTGATAGAAGGCCCAGCGGTAACTCGGGGCTATTTTGACGAAATGGAACAGACGCAAGCA
TCATATATCGATCCGCCAGCCTGGTTGCAGGAGTTTCGCGGGCCTGCTGAGCCTGGCCGCCTCTTCTGCTCTGGA
GACCTGGTGCAGTATGTACCTAACCGGCCAGGTTGGCTGCGCTACATTGGACGCAAGGATAAGCAAGTCAAAATC
CGTGCACAAAGGGTCGACCTGACGGAAGTCGAGCACCATGTCGATGAGCTACTCCCACCAGGCAGTCAGGCAATT
GCCGAGGTCCTGTTCCAGCACTCGTCTCCCCGCCAATCGAGCCAGCTTGCAGTATTCTTGGCCTTTGGTGAACAG
TTAACCAACAAAATGGACATCATATGCGCCCTCGATGAGCCATTCAGAAGATTAATAGCTGAAATCCACCCACAG
CTTCAGAAAAGGCTCCCTTCTTACATGGTCCCCACCCTCTTCTTTCCGGTATCTCACGTTCCTCAAACACCCACC
GGTAAGACCGATCGAAATCGGTTGCGGCAGTTGGTAGAAGGGTGGACGACCGAACAGCTGCTGCCATATCATCCG
TTCAGTACAGATTCAGCGCGTGCGCCAGTAGAGACGGCTGAGGAGCGCATCTGGCAGCACATGTGGTGCGAGGTA
CTCTGCATACGTCCCGAGAATATCGCCAGAACTAGTCATTTCTTTCACCTTGGCGGTGAGTCTGTTAGAGCGATG
AGGTTGGCCGGGTTGGCACAACGTGAGGGATGGATCATTTCCGTGCCAGATATTTTCGCTCATCCGACGCTATCG
GAAATGGCGAGTCTCGCTGTACCCTCCCCCAAGGGTGTGCCGGTTCCATCTCCAGACCGTTTCAGCCTGGTAGGA
AGCGGAAGGCGGGCATCATATCTGGTTAATATGGCGACTCACCAGTGCAACGTCACCAAAAGTGAGATAGAGGAT
ATATATCCTTGTACCCCGCTCCAGGAGACTCTCATAGCCTCAACGGTACAAAAAGGAGGCTCCTACCAAGCGCTG
GAAGCCTTTGATCTGATAGCCGATGTGGATTTGGAACGCTTGGAAATGGCGTGGCAAAAGACAGCGGCCGATCAT
GCTATCCTCCGCACGCGAATTATGCAAGACTATACCGGCGAACTGTTTCAGGTGGTAGTCAAAGGTCCGTTAGCA
TGGACCGCGGAACAAGCGGACATAAACCCTGAGAATGGGTTACTGCATTTCCAGCGTACCATGGGCATTGGGACA
CCCTTGATTCATCTAGTCCTTCTACAATCTCCCGGATCCACGATACCCGATCGTCTCTTGCTCTCGATACATCAC
GCATTGTACGATGGATGGTCCCTGCCCCTGTTGCTCGAGGAGGTCAATCAGAAATACATCGGCCCATATCGGGGC
CAAGACACAACCGTGCCTTTCAACGTATTTGTCTCGCATGTAATTAAATCCATGGACAGGTGTTGTCATTTTTGG
AAACAGGAGTTGGAAACGAAGACAGAAGCTCGACTATTTCCACGTTTGCCGGACGGGGCATACGAGCCACACCCA
CAGGCTATTTTGCAGGACCAAGTCTTTGTTAGCCCGACGCGGAATGAATCTGAGATAACCCTCGCAACCATGGTC
CAGGCATCTTGGGCATTGACAGTGAGTTGCTACTTGAACGCAAGCGATGTAGGGTTCGGGATCACCACCTCTGGA
CGAGCTGCCCCTGTTCCGGGAATCGATCGACTGTTGGGACCTACGCTGGTTACATTGCCCCGACGCATACATATC
CAGAACACCCTGGATATCAAACTTTTCCTACGGCAACTACAGCAGCGCTTTACGGAGCAGTCCAAGTATGAACAC
ATTGGACTGCAGCAGATTCGCCAGCTAGGGCCATCGGCGGCCAGCGCGTGTCGCTTCCAGACTCTCCTAGTCATT
CAGCCCGACCAGCCAAAGCGCCAGCTGGCTTGGGCTGGAAACCACCAGAGTGCGGCCGAATTGACGCAGTTTAGC
AATGTTGCGTTAACCCTGATCTGCCAGCTCCCCTCTCCCTCCTCGACGTCCATTGGCCTGACAGCAGTTTACGAC
CCTCGAGTACTGGCACCCGCACAGATGCAGCGGGTTCTGTCGCAAGTTGGCCATGTCTTCAGAGAGTTACAGGAT
GCTCCAGACGGTGTTCCCATCGCCTCGCTCAATATGCTGAACCCCAGTGACTCCGCAGAACTGCAACAGTGGAAT
AAGCTCACTGTTCCTACTGGAAAGCATCAAGATCAAGAATTTGTGCATGACATGATACGGCGGCAATGCCAGCTT
CAACCAGACGCCGTAGCCGTTGAGGCATGGGACGGAAGCCTCACTTATGAAGAGCTGGATTCCTACACGGAGTAC
CTGGCTGCGAAACTGCAGCTATGTGGTGTTCGCAACGACCACTTCATTGCTCTCTACTTCGAGAAGTCATGTTGG
ACCATTGTCGCCCAACTGGCGGTCCTGAAAGCCGGAGGGGCCCTAGTGATGCTAGAGCCTTCTCATCCCGTTGAT
CGCCGTCGGGAGATTTGCCAGACTTTGGATGTCATGTTAATCCTTGGTCCTCCTCACCTCACTCATTCGTTGGAA
CAGGAGCTCAATATCAAGGTACTACCTATCAGCAAGGCTCATCTCAAAGCGTCGGATGGGGAACATCTATCAGTC
GACAGTCATATACAGTCTCATAACCTCATGTATGCCATCGCTACATCCGGGACTACTGGTTGTCCTAAGCTCGCA
TTGGTTCATCATGGCGGTTTTGTTGCCACTGCAAGGACCTTGGTTGATAGGCTCCTCTTACTGGCATCGTCTCGG
GTGCTTCAATTCTCTAGTTACGGATTCGACGCAAGCTTAGTGGAACAACTGCTTCCGTTAATTGTAGGAGGCTGC
GTCTGTGTTCCCACCCCCTTTGACCGTGATAACCGCCTAGCGTTCACGATGGCGACCATGAAGATCAATTGGATG
GTTGCACCAGCATCAGTGATTCACCTACTTTCACCTGATACGGTCCCAACACTACAGACATTAATATCTGCGGGT
GAGCCATTGCAGCAAAGTATAATCGATGTGTGGGCCACTCGAGTCAACCTCATAAATGCATACGGCCCAGCAGAG
TGCAGTATGGTGTGCTCGGTCAACCCAAGCGTAAGGCCGGGAACCGATCCGAACAATATCGGATACCCAATTGGT
GGCACCTGTTGGATAGTAGACCCAAATGATATCAACACCCTTTTGCCAATTGGTGCTGAAGGAGAACTCCTGGTG
GAAGGGCCGAACGTCGGTGTCGGATATGCGAAAGACCCTCGGCGCACAAGAGTTGCATTTTCATCATCACCGCCT
CACTGGCTCCGCTCCATTCACGGAGAATCAGTCCACACTCGAATATACCGCACAGGAGATATCGCTCGATATAAT
CCCGACGGATCTGTGCTTTACGTGGGCCGTAAGGATTCACAAATCAAATTACATGGGCAGCGGATCGAGCTCGCC
GAGGTGGAACATCATGTCAGGCTATGTTTCCCAGGCGCCATCCAGGTAGTTGTTGAGATGGTCAAGTTTGACGAT
TTTGAAACTAGCTCCCTCGTTGCCCTCATCGTCGTGTCTGGCTCAGGCTTTCCAGCGTCTGGATCAAACATCCTG
CTCCCAACAACCGCAAATTTCCTCAACAATGTTCAACACGCGGAAGCACTCCTGCAGGATCGTATCCCACCCTAT
ATGATCCCGACGCTGTTCGTACCGGTGGCACAGATTCCCTTCAATACCAATGGCAAGGCAGATCGTGCTCGTCTG
AGAACCTCGGTTGCTTCTCTGTCCATCCATGATCGTATAGGCTATCGCTCCACGGCCACAACAAAGCCTAACACA
GATCTAGAAATTGTGCTTCATGGAATCTGGTCCCGTGTTTTGCGGATCTCACCTCAGAAGCTTGGCATCCATGAA
AGCTTCTTTCGGGTAGGCGGCAATTCTATTAGCAGTATGCAACTAGCGGCGCAGTGCAACGAGGCTGGCCTTCCA
ATATCCATCCAGGATATCTTCCGTTGCCGAACAATTTCGCGGTTGGCGTCATCATTCAAGGGTCATCCTGTCCAG
GCGGACAGATCTTTAGAAGCACATAGCCAGGATGGATCACTGGGCCCAGTGCAGCGGCTGCTGCCTGAAGTAGGG
CACCCCAAGGCTCCAGTGGATTCTACTCTTGCCGCCTTCACTGATGGCCAGTTCGAGGAGATAAATAACGGCATC
CCGGCTGGATATGAAGGGCAGATACAAGATATCTACCCCTGCTCCCATGCACAGCAGGGCATGCTCATCAGCAAC
ACACGCAACTCCAGCCTCTATCAGCAAGTCTATCGCTTTGAAGTGGTTAGAGGTTGTGATGCGCCCAACGTTGAC
TGTCAGCAGTTGGTAAGGGCGTGGCATGCGGTAGTCAAGCGACATGGAGCCCTGCGGACCGTTTTCCTTGATATA
CCAGGGAGAGGGTTCCACCAGATCGTGCTCGTCAATGCAATAGACAATGTCATAATTGCGGCTGACGGCAACCAT
AGCAGTACATGTACCCAAAAGAGACCTGGTACACAAGACCTGTATGGTCCTTTACCAACTCTAATTATTCACCAG
GAGTATGATGAGCGGCTTTGGATCGAACTGCATATAAGTCATGCTCTTCTAGATGGAGTGTCACTGCGAATCATC
GAACAAGACCTCGTGAAAGCATACTACAACAACCTACCCTCTTCATTACCTGACTATCGGGATTACGTCACCTAT
CTGCGGGCAAAAGGAGATACGGAAATGTCATTGAGCTACTGGAAAAAATACCTGGAGGGTGCGCAGCCCTGCCTC
TTTCCACGCCTCCGTGACTCTACAGCAGCAGTGACAGACGTGTCGGAGCCAAAGGCGACAGTCGACTTCGTGTCG
CTTGACTTGGGCCCTCCGAAGTCTCTTGATCAGTTGTGTGAGACTCATTGCCTGAGCCTTACCGCTATCTTGCAT
GTAGTTTGGGCCATTGTGCTGCAGCAATATACCGGAACGGACAGCGTGTGCTTTGGATATGCCACATCCGCGCGG
CATGTCCCCATCCCTCATGTGGATGAAATAGTTGGTCCAATGATCAACACGCTGCCCAGTCAAATCCAACTCTCT
AGGGATTCATCAGTACTGTCCACTTTACAAAAGTACACCGTTCACTTCATGTCCTGCATGGAGCATGCCTACGTC
TCACTTGGACAGATATTACACTCGGCTATGTCCAGTACACAATCACCCTTCAACACAATGATAACTATTGTTGAG
ACTGGAGATCGTAGAGACGACGCTGATGGATCCTGCTTATCGTTGGTTTGTATGGATGGACATGGGGAGACAGAG
GTATGCATCCCCGTATTCCTACACGGCGAACCTGACGACTGACTGCTCCCTTCACATCCCTCAGTATGCGTTGGC
CTTGACTGTTTCCAAAGCATCGAGCCGCATGGATTTGCACCTTTCATACCAAACATCCATGGTCAATGCTTCTCA
GGCCCATGATGTGTGCCTGATGTTTCAAAAAGTCCTGTGTGAGGTCTTGGAGTGGCCCACGGCCAAGATTGGTGC
CATTGATGCCCTGAATATGGGTCAGAGACAGCGCATGGAATCGAGGCAGCCTACCCCACCGGCTGCTGCAAATAC
ATTGATATACGAAACCATCAATCGGCGATGTGCAGAGCAACCATCCTCATCAGCCGTCTGTGCCTGGGATGGTGA
ATTTACCTACGGGGAAATTGATCAGCTCTCATCAGTATTGGCGGGAGAGATCCTTGCCCATGGAGTTAAACCGGA
GGACCCGGTTTTGGTATGCCTTGAAAAGAGCCGCTGGGTTCCGGTGGTTATGCTGGCAGTCTGGAAAGCCGGGGC
ATGCTTAATTCTTCTGGATGCCACCCATCCAACTACCCGATTGCATATGATTGCCAAGCAATCTGCCGCATCACT
GGCAATTGCAAATAGAAGTACGCGCTCCAAAGCAAACATCCTGTGCTCACGAGTATTGCAAGTCGATGATGACCG
CTTGTGGACTCGACATGTTAACTCCTCGCGGGCCGAGATGGTTCATGTTGACGGACACAGCGCTGCATACATTAT
ATTCACATCTGGCTCGACTGGAACACCCAAAGGGGCTGTGATTGAACATGCTTCCCTTTCCATTGCGTGGGAGAC
CCTCATTACTCGACTACAGTTAAACCCGACATCGCGTGTTCTACAGTTTGCCTCCCATTCCTGGGATGCGGCAAT
CATCGATGTTATGGCCGCATTGATGTCAGGAGGCTGTCTCTGTGTACCCTCGGAAAACGAACGTATGGGGCATTT
GGCCTTAGCTGCGAATCGTATGCGAGCCAATTGGATGCTACTGACCCCAACTGTCGCCCGTCAGCTTACTCCTAG
CGAGTTTCTTTACCTCGAAACGCTAGTCCTTGGCGGCGAACGGGTCAATACAACGGACATTGAAGTCTGGCATGA
TAAAGTCTGTCTCCTGAGCGCATATGGCCCAGCAGAGTGCACGCAAATCACGAGCGTGACGAGGCCGTTAGATAT
GACCTGTGATGCGCGGAACATCGGCGTCCCAAATGCCAGCGCTGGATGGGTTGTACGTCCGGACGACCCTGAACA
GCTCGTCCCCGACGGAGCCATTGGAGAGTTACTTATTGAGGGACCCATTGTGGGCCAGGGCTATTTAAATGAGCC
TCAGCGTACCTATCAAGCCTTCATTGAGGCCCCCAGTTGGTTGCAGGCCATTCGCTCCCCCGGTACCATTCGGGT
CTACAGAACTGGGGACCTGGTTCGGTTTGCAGCTGACGGGTCACTCATCTTTGTCGGACGCATGGATGACCAGGT
GAAGCTACACGGCCAGCGGTTAGAGCTGGGTGAGGTTGAACATCACGTTCAGCAGGCTTTCGCTGCATCGCTTAC
GGTGATTGATCTCATCCAACCCAAAGAGGAGCAACAAATGGGTCCGTTCCTCGCAGCATGTATCTTCTCTCCCGG
CCATGCTTGTAAATCACCATCTCATGCCGGCATTTGGGAGCCCCCTTCAGACACCTTTCGAAAGAAAGTTCAAGA
GGCTAGAACAGCATTGTATCAGAGCCTGCCTTCATACATGGTGCCTTCTGTGTTTCTGCCATTGGCATACCTGCC
CAAATCAACGACAGGAAAAATTGATCGAAAGCGTCTCCGCAATTACATCCTTGACATGTCCCAAGAGGAACTCAT
TACTTATAGCTCTCCCGATGTCAACTGGGTGGCCTCTGTCTTAACCCTCATGGAGACGCGCTTGCAGGATCATAT
TTCCAGTATCCTGCATAAACAACCTTGGCAGGTTTCACCCGATCAAGATCTCTTTCAGCTGGGAATGGATTCAGT
GCTAGCCATGGCCCTAATTGCAAGGCTGTACAAGGACGGCCTCAAGCTAACGGTCAGGGATATCTTTGAGCAACC
TCAGCTGCGTAACCTGGCTCTTGTGGTGCGAGAGACGTTGCGGCCAGATCAAGAAGGTGTCAGGAAAGCACACAG
CCGCAGCCCCCTTCTGCACTATGCGAAGGAGATTGCTGATGAGTGGAAGATGGCTTTAACCTCCATTGAGCACAT
TTTGCCAACTACCCGTTTCCAGCGAGAGAGCTTGGAGGCGCGACACAAAGTGTACTTTATTTTCCATTTTCATGG
CAAGATCGACTGTCAGCGTCTTCAGCATGCTGTGCAGGCTGCTGTAGACAAATACGCCATACTGCGAACGGTCTT
CATTCCTTGGGACGAGTCTACAGTTCAAATAACTTTAGGTGACGCCACTGTACCGGTGGAAATCACGACGACCGA
TCTGAATCCAGTAGAAATAGCAGGATCCATTTGCCGCGAGGATTCATCAGCACCCGTTGCTCCCGGCAAACTACA
CACCCAGCTTCGCTTGATCATGGGGTCCAACCGTGATTCAATGGCCCTTCGGTTGTCCCATGCTCAGTATGACGG
CATCAGCATGCCTCGCCTGTTCACGGACATCGCCCGGGCATATCAGGGGATAACTTTAAGTCCCGCTAAGGTGGA
CTTTCCGGAATACCTGCACAGCCGCATCTATAATATTCCTTCGCAGGCATACAAGTTCTGGCGCGACTTGCTCCG
AGGTTCCAGCATGACCTATCTACGTTCTGAATCTTCATCAGGGTCTCCGCCTTCCCATAATCGGGGAAGCCTTAT
AACGAGCACCACAGAGGTCTCATACCCGCCAGCCCCCGCTGGAACCACGATGGCCACCGTCGCCAAGGCAGCTTG
GGCCCTCTGCCTGGCACACATGGCTGGCACTCACGACATCGTATTCGGTCAGCTCGTCAACGGCCGAAACCTGGA
GCTGCCAGAGGCCGAAACGGTTGTGGGTGCCTGTGTCAATTACGTCCCAGTCCGTGTGACTCTCCAGGCTGACTG
GACCGTGTCAAGCCTCCTCCATGCGGTTCATCAGCAGCAAACCCGCAGCATGGCCTTCGAGACACTCGAATATGA
CGAGCTGGTGGCGCAGTGTACCTCCTGGCCGGCAGACACAGACCCGGGTACCGGGATCCACTACGTGAACATCCC
CGATGCGTTTGCTGGTAGCGGCCTGCCTGGGGTGGGGTCGGACTATGAGACCTATGTATCCCGCTTGCCTTATTA
TCATCCCCGTGTGACCTGTAGTCCCCTCTCGAAGGGAATACTTGAGCTTACGCTTTCCGTCTCGGATCAGCTGTG
GGATCAGAATCAGGCGGATCAGACTCTGCATCTGTTTGGGCAGACTGTGGTACGCATTCTGGAGAACCCAACAGG
GCTTGCTTGTGATGTTCTTAAAGCGCTGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail