Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g7241.t1
Gene name
Locationscaffold_050:1745..3564
Strand+
Gene length (bp)1819
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10281 Ish1 Putative nuclear envelope organisation protein 1.0E-06 30 65
PF10281 Ish1 Putative nuclear envelope organisation protein 3.4E-15 93 128
PF10281 Ish1 Putative nuclear envelope organisation protein 1.4E-12 148 183
PF10281 Ish1 Putative nuclear envelope organisation protein 1.4E-13 214 249
PF10281 Ish1 Putative nuclear envelope organisation protein 1.2E-10 305 336
PF10281 Ish1 Putative nuclear envelope organisation protein 3.5E-10 350 387
PF10281 Ish1 Putative nuclear envelope organisation protein 1.0E-11 418 453

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g7241.t1
MKLHLASYLVFALATFEAVGASSWFSKAVYNKWHETELERWLSDHDIPYPSPADRKDLESLVKSNWEAKVQKPLA
HVTQHSHDHWHDAKEWLFDTWSDSQLKAFLDRHGVPAPQPRKRDTLLKTARENYESIATKLGEAVAYPGNWVYEQ
WTESDLKEWLDERGWPVPQPTTRDRLIASVRRNARLASLNAKSIAASASASAEAAQATLSDALFKAWSDSDLKKF
LDEHGVKVPQGSRRNELVALARKHRASLVSQASEASATISSTATQIIGAATSKAGNEYGKATDVAESKAQDTFDT
VIQGWSDSRLKAFLDARGVPVPQSNKRDELLAKVRLHSHKAATGWSAWTFDTWDTEHLKKYLSSMNAKAAHRADI
TRDELVKQAQENYAKASKAGGANLASATSYMAQATDAAKGSAFDTWTHSDLKAYLDSYGIPVYQGSGINELRAAA
RRNAEYFRYGTSSPSGTIFAKMQEAGQWLLDQLKIGASSGRAQGQEAAEKAKAKGSEAAEKAKAQGSHAASSMRV
EL*
Coding >Ani_SJS100_1|g7241.t1
ATGAAGCTCCATTTGGCTTCGTATCTGGTATTTGCGCTTGCAACCTTTGAGGCGGTTGGAGCGTCCAGCTGGTTC
AGCAAGGCTGTTTACAACAAATGGCATGAGACTGAGTTAGAAAGATGGCTCTCCGATCATGACATCCCGTACCCA
TCGCCGGCCGATCGCAAGGATCTCGAGTCCCTAGTGAAGTCCAACTGGGAAGCTAAAGTCCAGAAGCCCCTAGCA
CATGTTACACAGCACTCTCATGATCACTGGCATGATGCCAAGGAATGGCTCTTTGACACGTGGTCCGACTCCCAG
TTGAAGGCGTTCCTTGATCGTCATGGTGTTCCTGCCCCCCAGCCTCGCAAGCGTGATACTCTTTTGAAAACTGCT
CGCGAAAACTATGAGTCTATTGCCACGAAGCTTGGGGAGGCTGTCGCCTATCCTGGTAACTGGGTATACGAGCAA
TGGACCGAGTCTGATCTAAAGGAATGGCTTGATGAGCGTGGCTGGCCGGTTCCACAGCCCACCACGCGCGACAGG
CTTATTGCATCGGTTCGTCGTAATGCTCGACTGGCCAGTTTGAACGCGAAGAGCATCGCTGCCTCTGCCTCTGCC
TCTGCGGAAGCTGCGCAGGCTACTCTGAGCGATGCCCTGTTCAAGGCTTGGTCCGACTCCGATCTGAAGAAGTTC
CTCGATGAACACGGTGTCAAGGTACCCCAAGGATCTCGCCGCAATGAACTCGTGGCTCTGGCGAGGAAGCACCGC
GCCTCTCTGGTTAGCCAGGCTTCGGAGGCCTCTGCCACCATTTCGTCCACCGCTACTCAGATCATTGGAGCCGCT
ACCTCCAAAGCTGGTAACGAATACGGCAAAGCCACCGATGTTGCCGAGTCCAAGGCCCAAGATACCTTCGATACC
GTAATTCAAGGCTGGTCTGACTCGCGCTTGAAGGCTTTCCTCGATGCGCGCGGAGTTCCCGTTCCTCAAAGCAAC
AAGCGTGACGAGCTCCTTGCTAAGGTGCGGCTCCACAGCCACAAGGCAGCTACTGGCTGGTCTGCTTGGACCTTT
GATACCTGGGACACCGAGCATTTGAAGAAGTACCTGTCCTCCATGAATGCCAAGGCAGCCCACCGCGCCGACATT
ACTCGCGACGAGCTTGTCAAGCAAGCCCAGGAGAACTACGCCAAGGCATCCAAAGCCGGAGGCGCAAACCTCGCA
TCGGCCACCTCATACATGGCGCAGGCCACCGATGCAGCCAAGGGTTCCGCCTTCGACACCTGGACCCATTCCGAT
CTCAAGGCTTACCTTGACTCGTACGGCATCCCGGTCTATCAGGGCTCCGGAATCAACGAACTCCGCGCCGCTGCT
CGCCGCAATGCGGAATACTTCCGCTATGGCACTTCGTCTCCTTCGGGAACCATCTTCGCTAAGATGCAAGAGGCC
GGCCAGTGGCTTCTGGATCAGCTGAAGATCGGCGCGTCCAGTGGCCGTGCCCAGGGTCAGGAAGCCGCTGAGAAG
GCCAAGGCTAAGGGGTCTGAGGCTGCTGAGAAAGCCAAGGCCCAGGGATCCCATGCTGCCTCGAGCATGCGGGTC
GAGCTGTAA
Transcript >Ani_SJS100_1|g7241.t1
ATGAAGCTCCATTTGGCTTCGTATCTGGTATTTGCGCTTGCAACCTTTGAGGCGGTTGGAGCGTCCAGCTGGTTC
AGCAAGGCTGTTTACAACAAATGGCATGAGACTGAGTTAGAAAGATGGCTCTCCGATCATGACATCCCGTACCCA
TCGCCGGCCGATCGCAAGGATCTCGAGTCCCTAGTGAAGTCCAACTGGGAAGCTAAAGTCCAGAAGCCCCTAGCA
CATGTTACACAGCACTCTCATGATCACTGGCATGATGCCAAGGAATGGCTCTTTGACACGTGGTCCGACTCCCAG
TTGAAGGCGTTCCTTGATCGTCATGGTGTTCCTGCCCCCCAGCCTCGCAAGCGTGATACTCTTTTGAAAACTGCT
CGCGAAAACTATGAGTCTATTGCCACGAAGCTTGGGGAGGCTGTCGCCTATCCTGGTAACTGGGTATACGAGCAA
TGGACCGAGTCTGATCTAAAGGAATGGCTTGATGAGCGTGGCTGGCCGGTTCCACAGCCCACCACGCGCGACAGG
CTTATTGCATCGGTTCGTCGTAATGCTCGACTGGCCAGTTTGAACGCGAAGAGCATCGCTGCCTCTGCCTCTGCC
TCTGCGGAAGCTGCGCAGGCTACTCTGAGCGATGCCCTGTTCAAGGCTTGGTCCGACTCCGATCTGAAGAAGTTC
CTCGATGAACACGGTGTCAAGGTACCCCAAGGATCTCGCCGCAATGAACTCGTGGCTCTGGCGAGGAAGCACCGC
GCCTCTCTGGTTAGCCAGGCTTCGGAGGCCTCTGCCACCATTTCGTCCACCGCTACTCAGATCATTGGAGCCGCT
ACCTCCAAAGCTGGTAACGAATACGGCAAAGCCACCGATGTTGCCGAGTCCAAGGCCCAAGATACCTTCGATACC
GTAATTCAAGGCTGGTCTGACTCGCGCTTGAAGGCTTTCCTCGATGCGCGCGGAGTTCCCGTTCCTCAAAGCAAC
AAGCGTGACGAGCTCCTTGCTAAGGTGCGGCTCCACAGCCACAAGGCAGCTACTGGCTGGTCTGCTTGGACCTTT
GATACCTGGGACACCGAGCATTTGAAGAAGTACCTGTCCTCCATGAATGCCAAGGCAGCCCACCGCGCCGACATT
ACTCGCGACGAGCTTGTCAAGCAAGCCCAGGAGAACTACGCCAAGGCATCCAAAGCCGGAGGCGCAAACCTCGCA
TCGGCCACCTCATACATGGCGCAGGCCACCGATGCAGCCAAGGGTTCCGCCTTCGACACCTGGACCCATTCCGAT
CTCAAGGCTTACCTTGACTCGTACGGCATCCCGGTCTATCAGGGCTCCGGAATCAACGAACTCCGCGCCGCTGCT
CGCCGCAATGCGGAATACTTCCGCTATGGCACTTCGTCTCCTTCGGGAACCATCTTCGCTAAGATGCAAGAGGCC
GGCCAGTGGCTTCTGGATCAGCTGAAGATCGGCGCGTCCAGTGGCCGTGCCCAGGGTCAGGAAGCCGCTGAGAAG
GCCAAGGCTAAGGGGTCTGAGGCTGCTGAGAAAGCCAAGGCCCAGGGATCCCATGCTGCCTCGAGCATGCGGGTC
GAGCTGTAA
Gene >Ani_SJS100_1|g7241.t1
ATGAAGCTCCATTTGGCTTCGTATCTGGTATTTGCGCTTGCAACCTTTGAGGCGGTTGGAGCGTCCAGCTGGTTC
AGCAAGGCTGGTATGTCAACTTCTGTACCATTGACTGATTTGACTGCTCCACATCGAGACACTCGCTAACACCCC
TTAGTTTACAACAAATGGCATGAGACTGAGTTAGAAAGATGGCTCTCCGATCATGGTATGCTGCTTCCTCCCATA
TATTCTTCCCATGAAGCATAGTTGACAACGTCTTTAGACATCCCGTACCCATCGCCGGCCGATCGCAAGGATCTC
GAGTCCCTAGTGAAGTCCAACTGGGAAGCTAAAGTCCAGAAGCCCCTAGCACATGTTACACAGCACTCTCATGAT
CACTGGCATGATGCCAAGGAATGGCTCTTTGACACGTAAGTCTATGCGAGATTGTCCTTCCCGTAGTTAGAATGT
ACTAATAGTCTACACAGGTGGTCCGACTCCCAGTTGAAGGCGTTCCTTGATCGTCATGGTGTTCCTGCCCCCCAG
CCTCGCAAGCGTGATACTCTTTTGAAAACTGCTCGCGAAAACTATGAGTCTATTGCCACGAAGCTTGGGGAGGCT
GTCGCCTATCCTGGTAACTGGGTATACGAGCAATGGACCGAGTCTGATCTAAAGGAATGGCTTGATGAGCGTGGC
TGGCCGGTTCCACAGCCCACCACGCGCGACAGGCTTATTGCATCGGTTCGTCGTAATGCTCGACTGGCCAGTTTG
AACGCGAAGAGCATCGCTGCCTCTGCCTCTGCCTCTGCGGAAGCTGCGCAGGCTACTCTGAGCGATGCCCTGTTC
AAGGCTTGGTCCGACTCCGATCTGAAGAAGTTCCTCGATGAACACGGTGTCAAGGTACCCCAAGGATCTCGCCGC
AATGAACTCGTGGCTCTGGCGAGGAAGCACCGCGCCTCTCTGGTTAGCCAGGCTTCGGAGGCCTCTGCCACCATT
TCGTCCACCGCTACTCAGATCATTGGAGCCGCTACCTCCAAAGCTGGTAACGAATACGGCAAAGCCACCGATGTT
GCCGAGTCCAAGGCCCAAGATACCTTCGATACCGTAATTCAAGGCTGGTCTGACTCGCGCTTGAAGGCTTTCCTC
GATGCGCGCGGAGTTCCCGTTCCTCAAAGCAACAAGCGTGACGAGCTCCTTGCTAAGGTGCGGCTCCACAGCCAC
AAGGCAGCTACTGGCTGGTCTGCTTGGACCTTTGATACCTGGGACACCGAGCATTTGAAGTAAGACTCCTACTTG
GATAACTTTAGACAACATTCTCTAACATATATATAGGAAGTACCTGTCCTCCATGAATGCCAAGGCAGCCCACCG
CGCCGACATTACTCGCGACGAGCTTGTCAAGCAAGCCCAGGAGAACTACGCCAAGGCATCCAAAGCCGGAGGCGC
AAACCTCGCATCGGCCACCTCATACATGGCGCAGGCCACCGATGCAGCCAAGGGTTCCGCCTTCGACACCTGGAC
CCATTCCGATCTCAAGGCTTACCTTGACTCGTACGGCATCCCGGTCTATCAGGGCTCCGGAATCAACGAACTCCG
CGCCGCTGCTCGCCGCAATGCGGAATACTTCCGCTATGGCACTTCGTCTCCTTCGGGAACCATCTTCGCTAAGAT
GCAAGAGGCCGGCCAGTGGCTTCTGGATCAGCTGAAGATCGGCGCGTCCAGTGGCCGTGCCCAGGGTCAGGAAGC
CGCTGAGAAGGCCAAGGCTAAGGGGTCTGAGGCTGCTGAGAAAGCCAAGGCCCAGGGATCCCATGCTGCCTCGAG
CATGCGGGTCGAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail