Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6975.t1
Gene name
Locationscaffold_046:102398..104728
Strand-
Gene length (bp)2330
Transcript length (bp)1962
Coding sequence length (bp)1962
Protein length (aa) 654

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.0E-31 90 256
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 2.5E-09 82 520

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 116 138 22
3 145 167 22
4 171 193 22
5 206 227 21
6 231 253 22
7 274 296 22
8 311 333 22
9 365 387 22
10 397 419 22
11 426 448 22
12 491 513 22
13 560 582 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6975.t1
MIKAYKYISQKTKDSKSPAPKPLCAHRSQWYQLESTNREDSESLERPMSGSTKGLSPATGTDKCRLCKEQKHNAR
VYRVKLIAGLTLPFTLSTLDLTIVATATSTIASHFNQFDELNWIITAFSLTSTTFIPIFGQLADVFGRHIVLQTA
LFFMLIGSVLCAAAQTWGMLLLGRALQGVGSAGLNNIIMIILADKVSLKENARNKSIFTIFGGVGYAVGPVIGGY
LTDSNWRYCFVVPIPIAVLSHIMIFVLLRNDLVEGTMFKKGSRWSSILPALATIDLGGSILFIFGVGLIILGTTW
GGATYSWSSPQVLAPLIIGAICFIAFFVYEYLLEPGRLFARIFPKHVTMLPYGLFERTDTIWLAIVNFSTGVASY
SIFYFISIYYILVAGYSTSKAGLELLYYIPGLGAGVYLAIYFCNGFPRQTFFPLLMGAVLSTVGLSVVAYAISAQ
ETSLLSGMLVITGAGVGLRLMPSSLHTVGIWPERIAPAMSLMQVSLPFGGTLGLTIMTSVFNNKFGRSSALRGLE
GTGSSLNVHDTDSLAFLDNLPAAVQDSIRMAAKNAIMWAFISIIPIVGLSLLTTTFMGNVWVNVRGKNDGEHVGE
DDGEGRSEVIHVPYLWALAKGTINTHKRISKPISSNTQPPSPLRQPTLQHSTA*
Coding >Ani_SJS100_1|g6975.t1
ATGATTAAAGCTTACAAGTACATATCGCAGAAGACGAAAGACTCCAAGTCTCCCGCACCAAAGCCACTTTGTGCA
CATCGCTCGCAATGGTACCAACTAGAGTCGACGAACCGCGAAGACTCCGAGTCCTTGGAAAGGCCTATGTCTGGC
TCCACAAAAGGATTGAGTCCTGCTACAGGTACTGATAAATGCAGGCTGTGTAAGGAGCAAAAGCACAATGCGCGA
GTGTATCGCGTTAAGCTCATTGCTGGTCTTACGCTGCCGTTTACTCTCTCCACACTGGACTTAACTATCGTTGCT
ACTGCGACCTCGACTATCGCATCTCACTTTAACCAGTTCGATGAGCTGAATTGGATCATAACCGCCTTTAGTCTC
ACATCAACCACCTTCATTCCCATATTCGGTCAGCTTGCCGATGTCTTTGGGCGTCATATTGTACTGCAGACGGCG
TTGTTTTTCATGCTTATTGGGAGTGTCCTGTGTGCAGCTGCGCAGACATGGGGTATGCTGCTGCTGGGTAGGGCT
TTGCAGGGTGTCGGCTCTGCGGGTCTGAACAATATCATTATGATTATTCTTGCCGACAAGGTGTCCTTGAAGGAG
AATGCAAGGAATAAGTCTATATTCACCATCTTTGGAGGAGTGGGATATGCTGTGGGCCCGGTTATCGGAGGGTAT
CTTACTGATAGCAATTGGCGATATTGCTTCGTTGTGCCTATTCCTATTGCTGTCCTCAGCCACATCATGATCTTT
GTGCTGCTGCGGAATGACCTTGTCGAAGGAACCATGTTCAAGAAGGGCTCAAGATGGTCCTCGATACTCCCAGCA
CTTGCTACCATAGATCTTGGAGGATCGATCCTTTTCATATTTGGTGTTGGCCTCATCATCCTAGGCACTACATGG
GGTGGCGCCACTTACTCCTGGTCGTCTCCTCAGGTGCTGGCACCATTGATCATCGGTGCAATCTGCTTCATCGCA
TTCTTTGTGTACGAGTACCTCCTTGAACCAGGTAGATTGTTCGCACGCATCTTCCCGAAGCACGTGACGATGCTT
CCATACGGCCTTTTCGAACGAACAGACACAATCTGGCTTGCCATAGTGAACTTTTCCACTGGCGTAGCCTCATAC
TCCATCTTCTACTTTATCAGCATTTACTACATCTTGGTTGCAGGTTACTCTACCTCAAAGGCAGGCCTAGAACTC
TTATACTACATCCCCGGACTAGGAGCTGGTGTCTACCTAGCAATATACTTTTGCAACGGCTTCCCTCGCCAAACC
TTTTTTCCCCTCCTCATGGGAGCAGTGCTTAGCACCGTCGGTCTCTCAGTAGTGGCTTACGCCATCAGCGCACAA
GAGACCAGCCTGCTAAGCGGAATGCTGGTCATCACCGGCGCTGGAGTCGGACTGCGCCTGATGCCATCCTCGCTC
CACACAGTGGGCATCTGGCCGGAGCGGATAGCACCAGCGATGTCTTTGATGCAGGTCTCGCTTCCCTTTGGGGGC
ACGCTCGGCTTGACCATCATGACCAGTGTCTTCAATAACAAGTTCGGCCGCTCCTCTGCCTTAAGGGGCCTAGAG
GGGACGGGCAGCTCGCTGAACGTCCATGATACCGACTCGTTAGCATTTCTCGACAATCTGCCCGCAGCAGTGCAA
GACAGCATCCGCATGGCTGCTAAGAATGCCATCATGTGGGCATTCATCTCGATCATCCCCATAGTAGGACTGAGT
CTCTTAACGACTACATTCATGGGCAACGTCTGGGTAAACGTTCGAGGAAAGAACGACGGAGAGCACGTCGGGGAA
GACGATGGCGAGGGACGGAGCGAAGTCATTCACGTTCCTTATTTATGGGCTCTTGCCAAGGGCACCATAAACACC
CACAAGCGCATCAGCAAGCCCATCTCAAGCAACACACAGCCACCATCACCACTCCGTCAACCCACCCTACAACAC
AGCACAGCATAG
Transcript >Ani_SJS100_1|g6975.t1
ATGATTAAAGCTTACAAGTACATATCGCAGAAGACGAAAGACTCCAAGTCTCCCGCACCAAAGCCACTTTGTGCA
CATCGCTCGCAATGGTACCAACTAGAGTCGACGAACCGCGAAGACTCCGAGTCCTTGGAAAGGCCTATGTCTGGC
TCCACAAAAGGATTGAGTCCTGCTACAGGTACTGATAAATGCAGGCTGTGTAAGGAGCAAAAGCACAATGCGCGA
GTGTATCGCGTTAAGCTCATTGCTGGTCTTACGCTGCCGTTTACTCTCTCCACACTGGACTTAACTATCGTTGCT
ACTGCGACCTCGACTATCGCATCTCACTTTAACCAGTTCGATGAGCTGAATTGGATCATAACCGCCTTTAGTCTC
ACATCAACCACCTTCATTCCCATATTCGGTCAGCTTGCCGATGTCTTTGGGCGTCATATTGTACTGCAGACGGCG
TTGTTTTTCATGCTTATTGGGAGTGTCCTGTGTGCAGCTGCGCAGACATGGGGTATGCTGCTGCTGGGTAGGGCT
TTGCAGGGTGTCGGCTCTGCGGGTCTGAACAATATCATTATGATTATTCTTGCCGACAAGGTGTCCTTGAAGGAG
AATGCAAGGAATAAGTCTATATTCACCATCTTTGGAGGAGTGGGATATGCTGTGGGCCCGGTTATCGGAGGGTAT
CTTACTGATAGCAATTGGCGATATTGCTTCGTTGTGCCTATTCCTATTGCTGTCCTCAGCCACATCATGATCTTT
GTGCTGCTGCGGAATGACCTTGTCGAAGGAACCATGTTCAAGAAGGGCTCAAGATGGTCCTCGATACTCCCAGCA
CTTGCTACCATAGATCTTGGAGGATCGATCCTTTTCATATTTGGTGTTGGCCTCATCATCCTAGGCACTACATGG
GGTGGCGCCACTTACTCCTGGTCGTCTCCTCAGGTGCTGGCACCATTGATCATCGGTGCAATCTGCTTCATCGCA
TTCTTTGTGTACGAGTACCTCCTTGAACCAGGTAGATTGTTCGCACGCATCTTCCCGAAGCACGTGACGATGCTT
CCATACGGCCTTTTCGAACGAACAGACACAATCTGGCTTGCCATAGTGAACTTTTCCACTGGCGTAGCCTCATAC
TCCATCTTCTACTTTATCAGCATTTACTACATCTTGGTTGCAGGTTACTCTACCTCAAAGGCAGGCCTAGAACTC
TTATACTACATCCCCGGACTAGGAGCTGGTGTCTACCTAGCAATATACTTTTGCAACGGCTTCCCTCGCCAAACC
TTTTTTCCCCTCCTCATGGGAGCAGTGCTTAGCACCGTCGGTCTCTCAGTAGTGGCTTACGCCATCAGCGCACAA
GAGACCAGCCTGCTAAGCGGAATGCTGGTCATCACCGGCGCTGGAGTCGGACTGCGCCTGATGCCATCCTCGCTC
CACACAGTGGGCATCTGGCCGGAGCGGATAGCACCAGCGATGTCTTTGATGCAGGTCTCGCTTCCCTTTGGGGGC
ACGCTCGGCTTGACCATCATGACCAGTGTCTTCAATAACAAGTTCGGCCGCTCCTCTGCCTTAAGGGGCCTAGAG
GGGACGGGCAGCTCGCTGAACGTCCATGATACCGACTCGTTAGCATTTCTCGACAATCTGCCCGCAGCAGTGCAA
GACAGCATCCGCATGGCTGCTAAGAATGCCATCATGTGGGCATTCATCTCGATCATCCCCATAGTAGGACTGAGT
CTCTTAACGACTACATTCATGGGCAACGTCTGGGTAAACGTTCGAGGAAAGAACGACGGAGAGCACGTCGGGGAA
GACGATGGCGAGGGACGGAGCGAAGTCATTCACGTTCCTTATTTATGGGCTCTTGCCAAGGGCACCATAAACACC
CACAAGCGCATCAGCAAGCCCATCTCAAGCAACACACAGCCACCATCACCACTCCGTCAACCCACCCTACAACAC
AGCACAGCATAG
Gene >Ani_SJS100_1|g6975.t1
ATGATTAAAGCTTACAAGTACATATCGCAGAAGACGAAAGACTCCAAGTCTCCCGCACCAAAGCCACTTTGTGCA
CATCGCTCGCAATGGTACCAACTAGAGTCGACGAACCGCGAAGACTCCGAGTCCTTGGAAAGGCCTATGTCTGGC
TCCACAAAAGGATTGAGTCCTGCTACAGGTACTGATAAATGCAGGCTGTGTAAGGAGCAAAAGCACAATGCGCGA
GTGTATCGCGTTAAGCTCATTGCTGGTCTTACGCTGCCGTTTACTCTCTCCACACTGGACTTAACTATCGTTGCT
ACTGCGACCTCGACTATCGCATCTCACTTTAGTAAGACAGAAGACTCTTGCGCCTGATTGTTCTTTCCTGACCAT
GTACGCTGTTTCTAGACCAGTTCGATGAGCTGAATTGGATCATAACCGCCTTTAGTCTCACATCAACCACCTTCA
TTCCCATATTCGGTCAGCTTGCCGATGTCTTTGGGCGTCATATTGTACTGCAGACGGCGTTGTTTTTCATGCTTA
TTGGGAGTGTCCTGTGTGCAGCTGCGCAGACATGGGGTATGCTGCTGCTGGGTAGGGCTTTGCAGGGTGTCGGCT
CTGCGGGTCTGAACAATATCATTATGATTATTCTTGCCGACAAGGTGTCCTTGAAGGAGAATGCAAGGAATAAGT
CTATATTCACCATCTTTGGAGGAGTGGGATATGCTGTGGGCCCGGTTATCGGAGGGTAAGTGGCCTATCTGAGAA
TGCTATGTACACTGCTAATGATTGCATTGTAGGTATCTTACTGATGTGGGTAGCCTGGTTGCACGCTCTATACTG
TTACTAACGAGATGATAGAGCAATTGGCGATATTGCTTCGTTGTGCCTATTCCTGTAAGTTTGACGGTGCTTTAC
TCTATGCAAAGGCTGATCAGATTAGATTGCTGTCCTCAGCCACATCATGATCTTTGTGCTGCTGCGGAATGACCT
TGTCGAAGGAACCATGTTCAAGAAGGGCTCAAGATGGTCCTCGATACTCCCAGCACTTGCTACCATAGATCTTGG
AGGATCGATCCTTTTCATATTTGGTGTTGGCCTCATCATCCTAGGCACTACATGGGGTGGCGCCACTTACTCCTG
GTCGTCTCCTCAGGTGCTGGCACCATTGATCATCGGTGCAATCTGCTTCATCGCATTCTTTGTGTACGAGTACCT
CCTTGAACCAGGTAGATTGTTCGCACGCATCTTCCCGAAGCACGTGACGATGCTTCCATACGGCCTTTTCGAACG
AACAGACACAATCTGGCTTGCCATAGTGAACTTTTCCACTGGCGTAGGTATGTGAAACTTAGCCATCCATGCTAC
ACGCACAACCGCTCACTGTCTTAGCCTCATACTCCATCTTCTACTTTATCAGCATTTACTACATCTTGGTTGCAG
GTTACTCTACCTCAAAGGCAGGCCTAGAACTCTTATACTACATCCCCGGACTAGGAGGTAAGACGCTTGCCAATC
GAGACCTGCAACTGACTAACCGTCATGCGTATAGCTGGTGTCTACCTAGCAATATACTTTTGCAACGGCTTCCCT
CGCCAAACCTTTTTTCCCCTCCTCATGGGAGCAGTGCTTAGCACCGTCGGTCTCTCAGTAGTGGCTTACGCCATC
AGCGCACAAGAGACCAGCCTGCTAAGCGGAATGCTGGTCATCACCGGCGCTGGAGTCGGACTGCGCCTGATGCCA
TCCTCGCTCCACACAGTGGGCATCTGGCCGGAGCGGATAGCACCAGCGATGTCTTTGATGCAGGTCTCGCTTCCC
TTTGGGGGCACGCTCGGCTTGACCATCATGACCAGTGTCTTCAATAACAAGTTCGGCCGCTCCTCTGCCTTAAGG
GGCCTAGAGGGGACGGGCAGCTCGCTGAACGTCCATGATACCGACTCGTTAGCATTTCTCGACAATCTGCCCGCA
GCAGTGCAAGACAGCATCCGCATGGCTGCTAAGAATGCCATCATGTGGGCATTCATCTCGATCATCCCCATAGTA
GGACTGAGTCTCTTAACGACTACATTCATGGGCAACGTCTGGGTAAACGTTCGAGGAAAGAACGACGGAGAGCAC
GTCGGGGAAGACGATGGCGAGGGACGGAGCGAAGTCATTCACGTTCCTTATTTATGGGCTCTTGCCAAGGTATAT
CGCCTCTTCCTACATCCTTACCAGAGAGAATGCTAATCAAACACACACCACAGGGCACCATAAACACCCACAAGC
GCATCAGCAAGCCCATCTCAAGCAACACACAGCCACCATCACCACTCCGTCAACCCACCCTACAACACAGCACAG
CATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail