Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6942.t1
Gene name
Locationscaffold_045:258968..259896
Strand+
Gene length (bp)928
Transcript length (bp)717
Coding sequence length (bp)717
Protein length (aa) 239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10681 Rot1 Chaperone for protein-folding within the ER, fungal 4.3E-96 27 235

GO

GO Term Description Terminal node
GO:0005783 endoplasmic reticulum Yes
GO:0006458 'de novo' protein folding Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:0006457 protein folding No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6942.t1
MMAMYFFLGLLLTAVGTSSSSSSASDLEGTWTTKSRQVVTGPGFYDPIGDKFLEPNLTGISYSFSADGHYEEAYY
RAIANPQDPSCPKGIMQWQHGTYTVNSDGSVDLTPIAVDGRQLLSDPCQSSTGTYTRYNQTEHFESFAVSVDSYH
GVQRLDVKNFDGSPMHPMYLIYKPPQMLPTQTLNPSSSSKSKRQVEGDTGGRFSIKDLVSREKVGDPNNWLWLGI
FMTTLGGITFFRS*
Coding >Ani_SJS100_1|g6942.t1
ATGATGGCAATGTACTTCTTCCTTGGCCTTCTGTTAACGGCCGTTGGTACCAGCAGCAGCAGCAGCAGCGCATCT
GATCTAGAAGGAACATGGACAACCAAGTCCCGCCAGGTTGTGACAGGTCCGGGCTTTTACGATCCTATTGGTGAT
AAATTCCTCGAACCCAATCTCACTGGTATCTCGTACTCGTTCAGCGCCGATGGACATTATGAAGAAGCCTACTAT
CGTGCCATTGCCAATCCCCAGGATCCTTCCTGCCCAAAAGGGATTATGCAATGGCAGCACGGTACCTATACCGTA
AACAGTGATGGATCGGTGGACCTGACCCCGATCGCTGTCGATGGACGCCAGCTTTTATCAGATCCTTGTCAGTCC
TCTACGGGTACCTATACCAGATACAACCAGACTGAGCACTTTGAGTCGTTTGCTGTCTCGGTAGATTCATACCAT
GGTGTCCAACGCCTTGACGTCAAGAATTTCGACGGATCGCCGATGCATCCAATGTATCTTATATACAAACCGCCA
CAGATGTTACCCACACAGACGCTCAATCCAAGCTCCTCCAGCAAGAGTAAACGCCAGGTCGAGGGAGATACTGGA
GGTCGCTTTAGCATAAAGGATTTGGTCAGCAGGGAGAAAGTTGGTGACCCGAATAACTGGCTGTGGCTTGGTATA
TTCATGACTACACTAGGAGGGATCACCTTCTTTCGCTCTTAG
Transcript >Ani_SJS100_1|g6942.t1
ATGATGGCAATGTACTTCTTCCTTGGCCTTCTGTTAACGGCCGTTGGTACCAGCAGCAGCAGCAGCAGCGCATCT
GATCTAGAAGGAACATGGACAACCAAGTCCCGCCAGGTTGTGACAGGTCCGGGCTTTTACGATCCTATTGGTGAT
AAATTCCTCGAACCCAATCTCACTGGTATCTCGTACTCGTTCAGCGCCGATGGACATTATGAAGAAGCCTACTAT
CGTGCCATTGCCAATCCCCAGGATCCTTCCTGCCCAAAAGGGATTATGCAATGGCAGCACGGTACCTATACCGTA
AACAGTGATGGATCGGTGGACCTGACCCCGATCGCTGTCGATGGACGCCAGCTTTTATCAGATCCTTGTCAGTCC
TCTACGGGTACCTATACCAGATACAACCAGACTGAGCACTTTGAGTCGTTTGCTGTCTCGGTAGATTCATACCAT
GGTGTCCAACGCCTTGACGTCAAGAATTTCGACGGATCGCCGATGCATCCAATGTATCTTATATACAAACCGCCA
CAGATGTTACCCACACAGACGCTCAATCCAAGCTCCTCCAGCAAGAGTAAACGCCAGGTCGAGGGAGATACTGGA
GGTCGCTTTAGCATAAAGGATTTGGTCAGCAGGGAGAAAGTTGGTGACCCGAATAACTGGCTGTGGCTTGGTATA
TTCATGACTACACTAGGAGGGATCACCTTCTTTCGCTCTTAG
Gene >Ani_SJS100_1|g6942.t1
ATGATGGCAATGTACTTCTTCCTTGGCCTTCTGTTAACGGCCGTTGGTACCAGCAGCAGCAGCAGCAGCGCATCT
GATCTAGAAGGAACATGGACAACCAAGTCCCGCCAGGTTGTGACAGGTCCGGTATGTTTTGCGCCGTGTTGATTG
TTTACCAGCCTCGATGGGCCAGCGCTACCTGTTCGCTAACCGTTCAACCTCTGATACTCACAGGGCTTTTACGAT
CCTATTGGTGATAAATTCCTCGAACCCAATCTCACTGGTATCTCGTACTCGTTCAGCGCCGATGGACATTATGAA
GAAGCCTACTATCGTGCCATTGCCAATCGTTAGTCCCAGAATTCTTGTAACTATGATAGCGCTTGCATTTCCCCG
GTTCTGACATGTCATGATCATTAAATAGCCCAGGATCCTTCCTGCCCAAAAGGGATTATGCAATGGCAGCACGGT
ACCTATACCGTAAACAGTGATGGATCGGTGGACCTGACCCCGATCGCTGTCGATGGACGCCAGCTTTTATCAGAT
CCTTGTCAGTCCTCTACGGGTACCTATACCAGATACAACCAGACTGAGCACTTTGAGGTACTTGGCCTCTGCCCC
TTTACTATATGAGAGCTACTGACAGGTATAGTCGTTTGCTGTCTCGGTAGATTCATACCATGGTGTCCAACGCCT
TGACGTCAAGAATTTCGACGGATCGCCGATGCATCCAATGTATCTTATATACAAACCGCCACAGATGTTACCCAC
ACAGACGCTCAATCCAAGCTCCTCCAGCAAGAGTAAACGCCAGGTCGAGGGAGATACTGGAGGTCGCTTTAGCAT
AAAGGATTTGGTCAGCAGGGAGAAAGTTGGTGACCCGAATAACTGGCTGTGGCTTGGTATATTCATGACTACACT
AGGAGGGATCACCTTCTTTCGCTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail