Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6839.t1
Gene name
Locationscaffold_044:167718..171466
Strand-
Gene length (bp)3748
Transcript length (bp)3543
Coding sequence length (bp)3543
Protein length (aa) 1181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04950 RIBIOP_C 40S ribosome biogenesis protein Tsr1 and BMS1 C-terminal 3.0E-99 698 1004
PF08142 AARP2CN AARP2CN (NUC121) domain 1.7E-27 214 301

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0042254 ribosome biogenesis Yes
GO:0044085 cellular component biogenesis No
GO:0071840 cellular component organization or biogenesis No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:0043226 organelle No
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6839.t1
MEEQSNRAHRPAKEKKKYDGPNPKAFAFSNPGKSNKAGARSHDIKEKRLHVPLVDRLPEEAPPLVVAIVGPPGVG
KTTLIKSLIRRYTKQTLSTPKGPLTVVTSKRRRLTFLECPSDSLASMVDVAKIADIVLLMIDGNYGFEMETMEFL
NVLGSHGMPGNVFGILTHLDLFKKQSTLRAAKKRLKHRFWSELYNGAKLFYLSGVVNGRYPDREVHNLSRFLSVM
KNPRPLIWRNSHPYALADRFLDITPPTQIEENPKCDRTIALYGYLRGTNFPASGARVHVPGVGDLTVSGIESLPD
PCPTPYMDQQLAKATGKNSKRRLGEKQKLLFAPMSDVGGVLVDKDAVYIDVKTSNFDRGDESDDEERGLGEQLVV
GLQGERKLLGEADSGVRLFRGGGAIGKADDEDEAVGRKHKRNVRFLDGEQDNHDAADDDEGFESDEGEEDEEDEE
DMEHDEEEDLSGDEEEVDASAPPDFEANFKERQNGNSRQKEDDIAFADSDSDLGSISSVEDQVLDSDEDEEDEED
DGEVRWKDNMLANAKALHSKRPKYRVPDLSRMLYDETITPADVIRRWSGKEEGDEDDDEEPEEDDDAFFRKTNVE
EEEAAEYRAVPEYDYAKLEAKWQDADMIESLRQRFVSAKLSGGDDDDSDVDDAFDEDDEGDGEFEDLETGEAFDG
FSDEEGAEDDEAADAEGPVDLDAERERNAKKKEELRLRFEEEDREGFANSKDNSRQAGGGGEEEFGEDEWYDMQK
AKLQKQIDINRAEFDMLDPASRARAEGFKAGTYARIVLENVPCEFATKFNPRFPVIVGGLAPTEDRFGYVQIRIK
RHRWHKKILKSNDPLIFSLGWRRFQSLPIYSTSDSRTRNRMLKYTPEHMHCFGTFYGPLVAPNTGFCCLQSFSNK
TPGFRIAATGVVLSVDEHTEIVKKLKLTGVPYKIFKNTAFIKDMFNSSIEIAKFEGASIRTVSGIRGQIKRALSK
PEGYFRATFEDKILMSDIVFLRAWYPIKPHRFYNPVTNLLDLDEESVGDNGWKAMRLTGEVRREKGIPTPMNKDS
AYHAIERPERHFNPLRVPRQLAADLPFKSQITKMKGRKDKTYMQKRAVVLGGEEKKARDLMQKLNTMRNEKQAKR
AAKQEERRQVYRAKVAEGLEKKAEREKRERDEYWRREGKKRKNQDSEGGGGKKRK*
Coding >Ani_SJS100_1|g6839.t1
ATGGAGGAGCAATCCAACAGGGCGCATCGCCCTGCTAAAGAGAAAAAGAAGTACGACGGTCCGAATCCGAAGGCT
TTCGCGTTCTCGAATCCTGGCAAATCGAACAAAGCCGGTGCGAGATCTCACGATATCAAAGAGAAGAGACTCCAT
GTGCCTCTTGTTGATCGCCTTCCTGAGGAGGCTCCGCCGCTCGTGGTGGCCATTGTTGGCCCACCGGGGGTTGGG
AAAACGACACTTATCAAGTCCTTGATCCGTCGATACACAAAACAGACCCTCAGTACCCCTAAGGGACCGTTGACT
GTTGTGACCTCCAAACGGCGCCGCCTTACCTTCCTCGAATGCCCCTCCGACTCCCTCGCCAGCATGGTCGATGTG
GCCAAGATCGCGGATATTGTGCTTCTGATGATCGACGGAAATTATGGCTTCGAGATGGAGACTATGGAATTCTTG
AACGTCCTGGGCTCTCACGGTATGCCCGGAAATGTTTTCGGTATCCTGACCCACTTGGACCTTTTCAAGAAGCAG
AGCACCCTGCGTGCTGCCAAGAAACGCCTGAAGCACCGCTTCTGGAGCGAGCTGTACAATGGTGCCAAGCTTTTC
TACCTTTCCGGAGTTGTCAATGGCCGTTACCCCGACCGTGAAGTGCACAATTTGTCCCGCTTCTTGTCTGTCATG
AAGAACCCGAGACCGCTCATTTGGCGCAACTCCCACCCTTACGCCCTCGCAGATCGATTCCTCGACATCACGCCA
CCTACTCAAATCGAAGAGAACCCGAAATGTGATCGGACAATAGCGCTTTATGGATACCTAAGAGGCACCAATTTC
CCTGCTTCTGGTGCGCGAGTGCATGTCCCAGGTGTGGGTGACTTGACTGTCTCTGGTATCGAGTCTCTCCCGGAT
CCATGCCCAACACCCTACATGGATCAGCAGTTGGCCAAAGCCACCGGCAAAAATAGCAAGCGCAGGCTGGGAGAG
AAGCAGAAGTTGCTTTTTGCCCCCATGTCCGACGTTGGTGGTGTCTTAGTCGATAAGGATGCTGTTTATATCGAT
GTGAAGACCTCGAACTTTGATCGCGGCGATGAATCCGACGATGAGGAGCGTGGCTTGGGAGAGCAGTTGGTCGTT
GGTCTTCAAGGAGAGCGCAAGCTTCTGGGAGAGGCAGACAGTGGTGTCCGTTTGTTCCGTGGCGGTGGTGCCATT
GGAAAAGCAGATGACGAGGATGAAGCTGTTGGCAGAAAGCACAAGAGGAACGTTCGATTCTTGGATGGCGAACAG
GACAATCATGATGCGGCGGACGATGATGAAGGCTTTGAAAGCGATGAGGGTGAAGAGGATGAGGAGGACGAGGAG
GACATGGAGCACGATGAGGAAGAGGACCTGAGCGGCGATGAGGAAGAGGTTGACGCTTCCGCGCCGCCAGATTTC
GAGGCCAATTTCAAGGAAAGGCAAAACGGCAATTCTCGCCAGAAAGAGGACGACATCGCTTTTGCCGACAGTGAC
TCCGACCTTGGTTCCATCTCGTCAGTAGAGGACCAGGTCCTCGATAGCGACGAGGACGAGGAAGACGAGGAAGAC
GACGGTGAAGTCCGTTGGAAGGACAATATGCTTGCCAATGCCAAGGCCCTCCATTCAAAGCGCCCTAAGTACCGT
GTCCCTGACTTGTCGCGCATGCTTTACGATGAAACCATCACACCTGCAGATGTGATACGCCGATGGAGTGGCAAG
GAGGAGGGGGACGAAGACGACGATGAAGAACCTGAAGAGGACGACGATGCCTTTTTCAGGAAGACAAACGTGGAG
GAGGAAGAAGCTGCGGAGTACCGTGCTGTTCCTGAGTACGACTACGCCAAGCTGGAAGCCAAATGGCAAGATGCA
GATATGATTGAATCTTTGCGGCAACGCTTCGTCAGCGCCAAACTGTCTGGCGGCGACGATGATGATTCGGATGTT
GATGATGCCTTTGATGAGGATGACGAGGGTGACGGAGAGTTTGAAGATTTGGAGACCGGCGAAGCTTTCGACGGG
TTTTCTGACGAAGAAGGCGCCGAGGACGATGAAGCTGCAGATGCCGAAGGTCCCGTCGACTTGGATGCGGAGCGA
GAACGTAATGCGAAGAAGAAGGAAGAATTGAGACTGCGCTTTGAGGAAGAAGACCGGGAAGGATTCGCTAACTCC
AAGGACAACTCCCGGCAGGCCGGTGGTGGTGGAGAAGAGGAATTCGGAGAGGACGAGTGGTATGATATGCAGAAG
GCCAAGCTCCAGAAGCAGATCGACATCAACCGTGCTGAATTCGATATGCTTGACCCGGCCTCGAGGGCTCGGGCC
GAAGGTTTCAAGGCTGGTACTTATGCACGTATTGTGCTCGAGAACGTTCCTTGCGAGTTCGCAACCAAGTTCAAC
CCCCGCTTCCCCGTGATTGTGGGTGGACTGGCCCCAACTGAAGACAGATTCGGTTATGTGCAGATCCGCATCAAG
AGGCATCGTTGGCATAAGAAGATCTTGAAGAGCAACGACCCTCTCATCTTCTCTCTCGGTTGGCGCCGCTTCCAG
TCTCTGCCGATATACAGCACTTCAGACAGTCGGACCCGTAACCGCATGCTCAAGTACACTCCCGAACACATGCAC
TGCTTTGGTACCTTCTATGGACCTCTCGTCGCACCTAACACCGGTTTCTGCTGCCTGCAATCATTCTCAAACAAG
ACCCCGGGATTCCGCATCGCCGCTACAGGTGTCGTACTGAGCGTCGACGAGCATACGGAGATCGTCAAGAAGCTC
AAGCTGACCGGTGTACCCTACAAGATCTTCAAGAACACTGCCTTCATCAAGGACATGTTCAACTCGTCTATCGAG
ATCGCCAAGTTCGAAGGGGCTTCCATCCGGACTGTATCTGGTATCCGTGGTCAAATCAAGCGTGCTCTCAGCAAG
CCCGAGGGTTACTTCCGTGCTACCTTCGAGGACAAGATTCTCATGAGTGATATTGTCTTCCTTCGCGCCTGGTAT
CCGATCAAGCCTCATCGCTTCTACAACCCTGTCACCAACTTGCTGGATCTGGACGAGGAAAGCGTCGGTGACAAC
GGCTGGAAGGCAATGCGTCTCACTGGTGAAGTCCGTCGTGAAAAGGGAATCCCTACCCCCATGAACAAGGACTCG
GCTTACCACGCCATTGAGCGCCCCGAGCGTCACTTCAACCCTCTTCGGGTGCCACGCCAGCTGGCGGCTGACCTT
CCCTTCAAGTCTCAAATTACGAAGATGAAGGGCCGGAAGGACAAGACCTACATGCAGAAGCGTGCTGTGGTCCTG
GGCGGTGAAGAGAAGAAGGCACGGGATCTCATGCAGAAGCTTAATACCATGCGCAATGAGAAGCAGGCCAAGCGC
GCGGCCAAGCAAGAGGAGCGGCGCCAGGTGTATCGGGCGAAGGTTGCGGAGGGTCTGGAAAAGAAGGCCGAGCGG
GAGAAGAGAGAACGGGATGAATACTGGCGCCGAGAAGGTAAGAAGCGCAAGAACCAAGACAGTGAAGGTGGCGGG
GGTAAGAAGCGCAAGTAA
Transcript >Ani_SJS100_1|g6839.t1
ATGGAGGAGCAATCCAACAGGGCGCATCGCCCTGCTAAAGAGAAAAAGAAGTACGACGGTCCGAATCCGAAGGCT
TTCGCGTTCTCGAATCCTGGCAAATCGAACAAAGCCGGTGCGAGATCTCACGATATCAAAGAGAAGAGACTCCAT
GTGCCTCTTGTTGATCGCCTTCCTGAGGAGGCTCCGCCGCTCGTGGTGGCCATTGTTGGCCCACCGGGGGTTGGG
AAAACGACACTTATCAAGTCCTTGATCCGTCGATACACAAAACAGACCCTCAGTACCCCTAAGGGACCGTTGACT
GTTGTGACCTCCAAACGGCGCCGCCTTACCTTCCTCGAATGCCCCTCCGACTCCCTCGCCAGCATGGTCGATGTG
GCCAAGATCGCGGATATTGTGCTTCTGATGATCGACGGAAATTATGGCTTCGAGATGGAGACTATGGAATTCTTG
AACGTCCTGGGCTCTCACGGTATGCCCGGAAATGTTTTCGGTATCCTGACCCACTTGGACCTTTTCAAGAAGCAG
AGCACCCTGCGTGCTGCCAAGAAACGCCTGAAGCACCGCTTCTGGAGCGAGCTGTACAATGGTGCCAAGCTTTTC
TACCTTTCCGGAGTTGTCAATGGCCGTTACCCCGACCGTGAAGTGCACAATTTGTCCCGCTTCTTGTCTGTCATG
AAGAACCCGAGACCGCTCATTTGGCGCAACTCCCACCCTTACGCCCTCGCAGATCGATTCCTCGACATCACGCCA
CCTACTCAAATCGAAGAGAACCCGAAATGTGATCGGACAATAGCGCTTTATGGATACCTAAGAGGCACCAATTTC
CCTGCTTCTGGTGCGCGAGTGCATGTCCCAGGTGTGGGTGACTTGACTGTCTCTGGTATCGAGTCTCTCCCGGAT
CCATGCCCAACACCCTACATGGATCAGCAGTTGGCCAAAGCCACCGGCAAAAATAGCAAGCGCAGGCTGGGAGAG
AAGCAGAAGTTGCTTTTTGCCCCCATGTCCGACGTTGGTGGTGTCTTAGTCGATAAGGATGCTGTTTATATCGAT
GTGAAGACCTCGAACTTTGATCGCGGCGATGAATCCGACGATGAGGAGCGTGGCTTGGGAGAGCAGTTGGTCGTT
GGTCTTCAAGGAGAGCGCAAGCTTCTGGGAGAGGCAGACAGTGGTGTCCGTTTGTTCCGTGGCGGTGGTGCCATT
GGAAAAGCAGATGACGAGGATGAAGCTGTTGGCAGAAAGCACAAGAGGAACGTTCGATTCTTGGATGGCGAACAG
GACAATCATGATGCGGCGGACGATGATGAAGGCTTTGAAAGCGATGAGGGTGAAGAGGATGAGGAGGACGAGGAG
GACATGGAGCACGATGAGGAAGAGGACCTGAGCGGCGATGAGGAAGAGGTTGACGCTTCCGCGCCGCCAGATTTC
GAGGCCAATTTCAAGGAAAGGCAAAACGGCAATTCTCGCCAGAAAGAGGACGACATCGCTTTTGCCGACAGTGAC
TCCGACCTTGGTTCCATCTCGTCAGTAGAGGACCAGGTCCTCGATAGCGACGAGGACGAGGAAGACGAGGAAGAC
GACGGTGAAGTCCGTTGGAAGGACAATATGCTTGCCAATGCCAAGGCCCTCCATTCAAAGCGCCCTAAGTACCGT
GTCCCTGACTTGTCGCGCATGCTTTACGATGAAACCATCACACCTGCAGATGTGATACGCCGATGGAGTGGCAAG
GAGGAGGGGGACGAAGACGACGATGAAGAACCTGAAGAGGACGACGATGCCTTTTTCAGGAAGACAAACGTGGAG
GAGGAAGAAGCTGCGGAGTACCGTGCTGTTCCTGAGTACGACTACGCCAAGCTGGAAGCCAAATGGCAAGATGCA
GATATGATTGAATCTTTGCGGCAACGCTTCGTCAGCGCCAAACTGTCTGGCGGCGACGATGATGATTCGGATGTT
GATGATGCCTTTGATGAGGATGACGAGGGTGACGGAGAGTTTGAAGATTTGGAGACCGGCGAAGCTTTCGACGGG
TTTTCTGACGAAGAAGGCGCCGAGGACGATGAAGCTGCAGATGCCGAAGGTCCCGTCGACTTGGATGCGGAGCGA
GAACGTAATGCGAAGAAGAAGGAAGAATTGAGACTGCGCTTTGAGGAAGAAGACCGGGAAGGATTCGCTAACTCC
AAGGACAACTCCCGGCAGGCCGGTGGTGGTGGAGAAGAGGAATTCGGAGAGGACGAGTGGTATGATATGCAGAAG
GCCAAGCTCCAGAAGCAGATCGACATCAACCGTGCTGAATTCGATATGCTTGACCCGGCCTCGAGGGCTCGGGCC
GAAGGTTTCAAGGCTGGTACTTATGCACGTATTGTGCTCGAGAACGTTCCTTGCGAGTTCGCAACCAAGTTCAAC
CCCCGCTTCCCCGTGATTGTGGGTGGACTGGCCCCAACTGAAGACAGATTCGGTTATGTGCAGATCCGCATCAAG
AGGCATCGTTGGCATAAGAAGATCTTGAAGAGCAACGACCCTCTCATCTTCTCTCTCGGTTGGCGCCGCTTCCAG
TCTCTGCCGATATACAGCACTTCAGACAGTCGGACCCGTAACCGCATGCTCAAGTACACTCCCGAACACATGCAC
TGCTTTGGTACCTTCTATGGACCTCTCGTCGCACCTAACACCGGTTTCTGCTGCCTGCAATCATTCTCAAACAAG
ACCCCGGGATTCCGCATCGCCGCTACAGGTGTCGTACTGAGCGTCGACGAGCATACGGAGATCGTCAAGAAGCTC
AAGCTGACCGGTGTACCCTACAAGATCTTCAAGAACACTGCCTTCATCAAGGACATGTTCAACTCGTCTATCGAG
ATCGCCAAGTTCGAAGGGGCTTCCATCCGGACTGTATCTGGTATCCGTGGTCAAATCAAGCGTGCTCTCAGCAAG
CCCGAGGGTTACTTCCGTGCTACCTTCGAGGACAAGATTCTCATGAGTGATATTGTCTTCCTTCGCGCCTGGTAT
CCGATCAAGCCTCATCGCTTCTACAACCCTGTCACCAACTTGCTGGATCTGGACGAGGAAAGCGTCGGTGACAAC
GGCTGGAAGGCAATGCGTCTCACTGGTGAAGTCCGTCGTGAAAAGGGAATCCCTACCCCCATGAACAAGGACTCG
GCTTACCACGCCATTGAGCGCCCCGAGCGTCACTTCAACCCTCTTCGGGTGCCACGCCAGCTGGCGGCTGACCTT
CCCTTCAAGTCTCAAATTACGAAGATGAAGGGCCGGAAGGACAAGACCTACATGCAGAAGCGTGCTGTGGTCCTG
GGCGGTGAAGAGAAGAAGGCACGGGATCTCATGCAGAAGCTTAATACCATGCGCAATGAGAAGCAGGCCAAGCGC
GCGGCCAAGCAAGAGGAGCGGCGCCAGGTGTATCGGGCGAAGGTTGCGGAGGGTCTGGAAAAGAAGGCCGAGCGG
GAGAAGAGAGAACGGGATGAATACTGGCGCCGAGAAGGTAAGAAGCGCAAGAACCAAGACAGTGAAGGTGGCGGG
GGTAAGAAGCGCAAGTAA
Gene >Ani_SJS100_1|g6839.t1
ATGGAGGAGCAATCCAACAGGGCGCATCGCCCTGCTAAAGAGAAAAAGAAGTACGACGGTATGTAGTACTTCAAA
GTCGAATCGCCGCTTCTCATGAAAAATAGTCAACTAACGTATCTTTCGCAACTCAGGTCCGAATCCGAAGGCTTT
CGCGTTCTCGAATCCTGGCAAATCGAACAAAGCCGGTGCGAGATCTCACGATGTATGCGCTACCACCCTCTTCAT
AACTCCGTACGCAACGGTCACTGATGCTCATTCTGCCGCATAGATCAAAGAGAAGAGACTCCATGTGCCTCTTGT
TGATCGCCTTCCTGAGGAGGCTCCGCCGCTCGTGGTGGCCATTGTTGGCCCACCGGGGGTACGTATCCTTGTCAA
TGATGCCATTGTCAGGGTTGCAACATGCTAATGCCTTCGCTGCTTATAGGTTGGGAAAACGACACTTATCAAGTC
CTTGATCCGTCGATACACAAAACAGACCCTCAGTACCCCTAAGGGACCGTTGACTGTTGTGACCTCCAAACGGCG
CCGCCTTACCTTCCTCGAATGCCCCTCCGACTCCCTCGCCAGCATGGTCGATGTGGCCAAGATCGCGGATATTGT
GCTTCTGATGATCGACGGAAATTATGGCTTCGAGATGGAGACTATGGAATTCTTGAACGTCCTGGGCTCTCACGG
TATGCCCGGAAATGTTTTCGGTATCCTGACCCACTTGGACCTTTTCAAGAAGCAGAGCACCCTGCGTGCTGCCAA
GAAACGCCTGAAGCACCGCTTCTGGAGCGAGCTGTACAATGGTGCCAAGCTTTTCTACCTTTCCGGAGTTGTCAA
TGGCCGTTACCCCGACCGTGAAGTGCACAATTTGTCCCGCTTCTTGTCTGTCATGAAGAACCCGAGACCGCTCAT
TTGGCGCAACTCCCACCCTTACGCCCTCGCAGATCGATTCCTCGACATCACGCCACCTACTCAAATCGAAGAGAA
CCCGAAATGTGATCGGACAATAGCGCTTTATGGATACCTAAGAGGCACCAATTTCCCTGCTTCTGGTGCGCGAGT
GCATGTCCCAGGTGTGGGTGACTTGACTGTCTCTGGTATCGAGTCTCTCCCGGATCCATGCCCAACACCCTACAT
GGATCAGCAGTTGGCCAAAGCCACCGGCAAAAATAGCAAGCGCAGGCTGGGAGAGAAGCAGAAGTTGCTTTTTGC
CCCCATGTCCGACGTTGGTGGTGTCTTAGTCGATAAGGATGCTGTTTATATCGATGTGAAGACCTCGAACTTTGA
TCGCGGCGATGAATCCGACGATGAGGAGCGTGGCTTGGGAGAGCAGTTGGTCGTTGGTCTTCAAGGAGAGCGCAA
GCTTCTGGGAGAGGCAGACAGTGGTGTCCGTTTGTTCCGTGGCGGTGGTGCCATTGGAAAAGCAGATGACGAGGA
TGAAGCTGTTGGCAGAAAGCACAAGAGGAACGTTCGATTCTTGGATGGCGAACAGGACAATCATGATGCGGCGGA
CGATGATGAAGGCTTTGAAAGCGATGAGGGTGAAGAGGATGAGGAGGACGAGGAGGACATGGAGCACGATGAGGA
AGAGGACCTGAGCGGCGATGAGGAAGAGGTTGACGCTTCCGCGCCGCCAGATTTCGAGGCCAATTTCAAGGAAAG
GCAAAACGGCAATTCTCGCCAGAAAGAGGACGACATCGCTTTTGCCGACAGTGACTCCGACCTTGGTTCCATCTC
GTCAGTAGAGGACCAGGTCCTCGATAGCGACGAGGACGAGGAAGACGAGGAAGACGACGGTGAAGTCCGTTGGAA
GGACAATATGCTTGCCAATGCCAAGGCCCTCCATTCAAAGCGCCCTAAGTACCGTGTCCCTGACTTGTCGCGCAT
GCTTTACGATGAAACCATCACACCTGCAGATGTGATACGCCGATGGAGTGGCAAGGAGGAGGGGGACGAAGACGA
CGATGAAGAACCTGAAGAGGACGACGATGCCTTTTTCAGGAAGACAAACGTGGAGGAGGAAGAAGCTGCGGAGTA
CCGTGCTGTTCCTGAGTACGACTACGCCAAGCTGGAAGCCAAATGGCAAGATGCAGATATGATTGAATCTTTGCG
GCAACGCTTCGTCAGCGCCAAACTGTCTGGCGGCGACGATGATGATTCGGATGTTGATGATGCCTTTGATGAGGA
TGACGAGGGTGACGGAGAGTTTGAAGATTTGGAGACCGGCGAAGCTTTCGACGGGTTTTCTGACGAAGAAGGCGC
CGAGGACGATGAAGCTGCAGATGCCGAAGGTCCCGTCGACTTGGATGCGGAGCGAGAACGTAATGCGAAGAAGAA
GGAAGAATTGAGACTGCGCTTTGAGGAAGAAGACCGGGAAGGATTCGCTAACTCCAAGGACAACTCCCGGCAGGC
CGGTGGTGGTGGAGAAGAGGAATTCGGAGAGGACGAGTGGTATGATATGCAGAAGGCCAAGCTCCAGAAGCAGAT
CGACATCAACCGTGCTGAATTCGATATGCTTGACCCGGCCTCGAGGGCTCGGGCCGAAGGTTTCAAGGCTGGTAC
TTATGCACGTATTGTGCTCGAGAACGTTCCTTGCGAGTTCGCAACCAAGTTCAACCCCCGCTTCCCCGTGATTGT
GGGTGGACTGGCCCCAACTGAAGACAGATTCGGTTATGTGCAGATCCGCATCAAGAGGCATCGTTGGCATAAGAA
GATCTTGAAGAGCAACGACCCTCTCATCTTCTCTCTCGGTTGGCGCCGCTTCCAGTCTCTGCCGATATACAGCAC
TTCAGACAGTCGGACCCGTAACCGCATGCTCAAGTACACTCCCGAACACATGCACTGCTTTGGTACCTTCTATGG
ACCTCTCGTCGCACCTAACACCGGTTTCTGCTGCCTGCAATCATTCTCAAACAAGACCCCGGGATTCCGCATCGC
CGCTACAGGTGTCGTACTGAGCGTCGACGAGCATACGGAGATCGTCAAGAAGCTCAAGCTGACCGGTGTACCCTA
CAAGATCTTCAAGAACACTGCCTTCATCAAGGACATGTTCAACTCGTCTATCGAGATCGCCAAGTTCGAAGGGGC
TTCCATCCGGACTGTATCTGGTATCCGTGGTCAAATCAAGCGTGCTCTCAGCAAGCCCGAGGGTTACTTCCGTGC
TACCTTCGAGGACAAGATTCTCATGAGTGATATTGTCTTCCTTCGCGCCTGGTATCCGATCAAGCCTCATCGCTT
CTACAACCCTGTCACCAACTTGCTGGATCTGGACGAGGAAAGCGTCGGTGACAACGGCTGGAAGGCAATGCGTCT
CACTGGTGAAGTCCGTCGTGAAAAGGGAATCCCTACCCCCATGAACAAGGACTCGGCTTACCACGCCATTGAGCG
CCCCGAGCGTCACTTCAACCCTCTTCGGGTGCCACGCCAGCTGGCGGCTGACCTTCCCTTCAAGTCTCAAATTAC
GAAGATGAAGGGCCGGAAGGACAAGACCTACATGCAGAAGCGTGCTGTGGTCCTGGGCGGTGAAGAGAAGAAGGC
ACGGGATCTCATGCAGAAGCTTAATACCATGCGCAATGAGAAGCAGGCCAAGCGCGCGGCCAAGCAAGAGGAGCG
GCGCCAGGTGTATCGGGCGAAGGTTGCGGAGGGTCTGGAAAAGAAGGCCGAGCGGGAGAAGAGAGAACGGGATGA
ATACTGGCGCCGAGAAGGTAAGAAGCGCAAGAACCAAGACAGTGAAGGTGGCGGGGGTAAGAAGCGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail