Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6774.t1
Gene name
Locationscaffold_043:222809..224572
Strand-
Gene length (bp)1763
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 2.0E-11 63 129
PF03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 1.2E-23 147 262
PF00984 UDPG_MGDP_dh UDP-glucose/GDP-mannose dehydrogenase family, central domain 2.0E-17 295 382
PF03720 UDPG_MGDP_dh_C UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain 9.8E-17 406 515

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0051287 NAD binding Yes
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6774.t1
MPFIPLLFVLASITLFFSRRRYKAIESAEPPVVVKGHTYSDSVDETELQPLESKKVEHVRSACIIGAGHVGALTA
VVLASQNPHIQFSVVDNDAGLINAWNSDRPPVFEPGLEEMLFEEISSLNLDASAIPDQSIASDCSQPRKRKLTNL
TFSTNVHAGVAAADLIFLCSEIFSTITIDEKERLDLSQLESAIRAIAQVSTGHKIIVQKSTAPCGVVQRMKKILR
KTASPSASFDVLSNPDFLVPGTALHDLLYPPRVIIGHIFSEDMSPGALSALKKLYIPWVPEERIITMDAWSSELG
KIAANAFLAQQISSLHSLSAICESTNANINHITQTLGLPQRVGFGFGSSHLQTEVLCLVYLARELGLQQVAEYWR
AVLRMNDSHNRRISQRVLSQLSGDLTEQKIAVLGFTPKENNNQYSVALGLVRDLSKNGVKVGIYDPFIPADQLEN
TLRASNASLETVTVADSVETACAGCSAVILHTDWETFGHEKVRWQGIAGQMQSPKVFLDPYGVFDQFKMQQWGFK
MLQVGVRQIEAK*
Coding >Ani_SJS100_1|g6774.t1
ATGCCATTCATTCCGCTACTCTTCGTCCTGGCGAGTATAACTTTGTTTTTTTCGCGACGTCGTTATAAAGCTATC
GAGAGCGCTGAGCCGCCGGTGGTTGTTAAGGGGCATACGTACTCTGATAGTGTGGATGAGACCGAGCTTCAGCCT
CTGGAGAGTAAGAAAGTTGAGCATGTTCGGAGTGCTTGTATCATTGGGGCTGGACATGTGGGTGCATTGACGGCG
GTTGTACTCGCCTCTCAGAATCCCCACATCCAGTTCAGTGTCGTTGACAATGATGCGGGTCTCATTAACGCGTGG
AACTCCGATCGGCCCCCAGTGTTTGAGCCTGGGTTGGAGGAGATGTTGTTTGAGGAGATATCAAGTCTCAATCTA
GATGCGTCAGCTATCCCGGATCAGTCTATAGCTTCAGATTGTAGTCAGCCTCGAAAGAGGAAACTGACGAACTTG
ACATTTTCCACAAACGTCCACGCAGGCGTGGCCGCAGCAGACCTGATCTTCCTATGTTCAGAGATATTCTCAACT
ATAACAATTGACGAAAAAGAGCGCTTAGATCTGTCGCAGTTGGAGTCTGCAATCCGAGCGATCGCTCAAGTATCC
ACTGGCCACAAGATTATCGTGCAGAAGAGCACCGCTCCATGTGGTGTCGTTCAGCGAATGAAGAAGATTTTGCGA
AAAACCGCTTCTCCATCCGCTTCATTCGATGTGCTGTCCAACCCCGACTTCTTGGTTCCAGGCACAGCCCTTCAT
GACCTCCTTTACCCTCCCCGCGTTATTATCGGGCACATATTCTCGGAAGACATGTCCCCAGGAGCTTTGAGCGCA
CTGAAGAAGCTTTACATTCCTTGGGTCCCAGAAGAGCGCATTATCACCATGGATGCATGGTCTTCGGAACTGGGC
AAGATTGCCGCCAACGCATTCCTCGCCCAACAAATTAGCAGTCTTCACTCGCTGAGCGCTATTTGTGAATCCACC
AACGCCAACATCAACCACATCACCCAGACCCTCGGGTTACCGCAACGAGTCGGCTTTGGATTCGGCAGCTCGCAC
TTGCAGACTGAGGTGCTGTGCCTAGTATATCTGGCCCGAGAGCTAGGACTGCAGCAAGTGGCAGAGTACTGGCGC
GCTGTCCTGCGCATGAACGATTCGCACAATCGACGTATCTCCCAACGAGTCCTGTCGCAGTTATCCGGCGACCTC
ACGGAGCAGAAGATTGCGGTTCTGGGGTTTACCCCAAAGGAGAACAACAACCAGTATTCTGTGGCGCTGGGTCTG
GTCCGGGACTTGTCAAAGAACGGGGTAAAAGTGGGCATTTATGACCCGTTTATACCTGCAGACCAGCTGGAGAAC
ACGCTGCGTGCGAGCAATGCATCTCTTGAGACGGTCACAGTGGCCGACTCAGTGGAGACGGCATGCGCGGGATGC
AGTGCTGTTATTCTTCACACGGACTGGGAGACGTTCGGACATGAGAAGGTTCGATGGCAGGGCATTGCGGGTCAG
ATGCAGAGCCCGAAGGTGTTCTTGGATCCTTATGGTGTGTTTGACCAGTTCAAGATGCAGCAGTGGGGATTCAAG
ATGTTGCAGGTGGGTGTGAGGCAGATAGAAGCAAAGTAA
Transcript >Ani_SJS100_1|g6774.t1
ATGCCATTCATTCCGCTACTCTTCGTCCTGGCGAGTATAACTTTGTTTTTTTCGCGACGTCGTTATAAAGCTATC
GAGAGCGCTGAGCCGCCGGTGGTTGTTAAGGGGCATACGTACTCTGATAGTGTGGATGAGACCGAGCTTCAGCCT
CTGGAGAGTAAGAAAGTTGAGCATGTTCGGAGTGCTTGTATCATTGGGGCTGGACATGTGGGTGCATTGACGGCG
GTTGTACTCGCCTCTCAGAATCCCCACATCCAGTTCAGTGTCGTTGACAATGATGCGGGTCTCATTAACGCGTGG
AACTCCGATCGGCCCCCAGTGTTTGAGCCTGGGTTGGAGGAGATGTTGTTTGAGGAGATATCAAGTCTCAATCTA
GATGCGTCAGCTATCCCGGATCAGTCTATAGCTTCAGATTGTAGTCAGCCTCGAAAGAGGAAACTGACGAACTTG
ACATTTTCCACAAACGTCCACGCAGGCGTGGCCGCAGCAGACCTGATCTTCCTATGTTCAGAGATATTCTCAACT
ATAACAATTGACGAAAAAGAGCGCTTAGATCTGTCGCAGTTGGAGTCTGCAATCCGAGCGATCGCTCAAGTATCC
ACTGGCCACAAGATTATCGTGCAGAAGAGCACCGCTCCATGTGGTGTCGTTCAGCGAATGAAGAAGATTTTGCGA
AAAACCGCTTCTCCATCCGCTTCATTCGATGTGCTGTCCAACCCCGACTTCTTGGTTCCAGGCACAGCCCTTCAT
GACCTCCTTTACCCTCCCCGCGTTATTATCGGGCACATATTCTCGGAAGACATGTCCCCAGGAGCTTTGAGCGCA
CTGAAGAAGCTTTACATTCCTTGGGTCCCAGAAGAGCGCATTATCACCATGGATGCATGGTCTTCGGAACTGGGC
AAGATTGCCGCCAACGCATTCCTCGCCCAACAAATTAGCAGTCTTCACTCGCTGAGCGCTATTTGTGAATCCACC
AACGCCAACATCAACCACATCACCCAGACCCTCGGGTTACCGCAACGAGTCGGCTTTGGATTCGGCAGCTCGCAC
TTGCAGACTGAGGTGCTGTGCCTAGTATATCTGGCCCGAGAGCTAGGACTGCAGCAAGTGGCAGAGTACTGGCGC
GCTGTCCTGCGCATGAACGATTCGCACAATCGACGTATCTCCCAACGAGTCCTGTCGCAGTTATCCGGCGACCTC
ACGGAGCAGAAGATTGCGGTTCTGGGGTTTACCCCAAAGGAGAACAACAACCAGTATTCTGTGGCGCTGGGTCTG
GTCCGGGACTTGTCAAAGAACGGGGTAAAAGTGGGCATTTATGACCCGTTTATACCTGCAGACCAGCTGGAGAAC
ACGCTGCGTGCGAGCAATGCATCTCTTGAGACGGTCACAGTGGCCGACTCAGTGGAGACGGCATGCGCGGGATGC
AGTGCTGTTATTCTTCACACGGACTGGGAGACGTTCGGACATGAGAAGGTTCGATGGCAGGGCATTGCGGGTCAG
ATGCAGAGCCCGAAGGTGTTCTTGGATCCTTATGGTGTGTTTGACCAGTTCAAGATGCAGCAGTGGGGATTCAAG
ATGTTGCAGGTGGGTGTGAGGCAGATAGAAGCAAAGTAA
Gene >Ani_SJS100_1|g6774.t1
ATGCCATTCATTCCGCTACTCTTCGTCCTGGCGAGTATAACTTTGTTTTTTTCGCGACGTCGTTATAAAGCTATC
GAGAGCGCTGAGCCGCCGGTGGTTGTTAAGGGGCATACGTACTCTGATAGTGTGGATGAGACCGAGCTTCAGCCT
CTGGAGAGTAAGAAAGTTGAGCATGTTCGGAGTGCTTGTATCATTGGGGCTGGACATGTGGGTAAGCGCGCTGCT
CTCACCTGCCAGTATCTCGGAAGGATAGCTAATGTCGGCCAGGTGCATTGACGGCGGTTGTACTCGCCTCTCAGA
ATCCCCACATCCAGTTCAGTGTCGTTGACAATGATGCGGGTCTCATTAACGCGTGGAACTCCGATCGGCCCCCAG
TGTTTGAGCCTGGGTTGGAGGAGATGTTGTTTGAGGAGATATCAAGTCTCAATCTAGATGCGTCAGCTATCCCGG
ATCAGTCTATAGCTTCAGATTGTAGTCAGCCTCGAAAGAGGAAACTGACGAACTTGACATTTTCCACAAACGTCC
ACGCAGGCGTGGCCGCAGCAGACCTGATCTTCCTATGTTCAGAGATATTCTCAACTATAACAGTAAGGCGTCTGC
TTGCATGTGGAAGACGAAGCTGATGATTGGTATAGATTGACGAAAAAGAGCGCTTAGATCTGTCGCAGTTGGAGT
CTGCAATCCGAGCGATCGCTCAAGTATCCACTGGCCACAAGATTATCGTGCAGAAGAGCACCGCTCCATGTGGTG
TCGTTCAGCGAATGAAGAAGATTGTGAGTATACTGTCAAATGTAGCAACATCATTCTAACGAAAGCAGTTGCGAA
AAACCGCTTCTCCATCCGCTTCATTCGATGTGCTGTCCAACCCCGACTTCTTGGTTCCAGGCACAGCCCTTCATG
ACCTCCTTTACCCTCCCCGCGTTATTATCGGGCACATATTCTCGGAAGACATGTCCCCAGGAGCTTTGAGCGCAC
TGAAGAAGCTTTACATTCCTTGGGTCCCAGAAGAGCGCATTATCACCATGGATGCATGGTCTTCGGAACTGGGCA
AGATTGCCGCCAACGCATTCCTCGCCCAACAAATTAGCAGTCTTCACTCGCTGAGCGCTATTTGTGAATCCACCA
ACGCCAACATCAACCACATCACCCAGACCCTCGGGTTACCGCAACGAGTCGGCTTTGGATTCGGCAGCTCGCACT
TGCAGACTGAGGTGCTGTGCCTAGTATATCTGGCCCGAGAGCTAGGACTGCAGCAAGTGGCAGAGTACTGGCGCG
CTGTCCTGCGCATGAACGATTCGCACAATCGACGTATCTCCCAACGAGTCCTGTCGCAGTTATCCGGCGACCTCA
CGGAGCAGAAGATTGCGGTTCTGGGGTTTACCCCAAAGGAGAACAACAACCAGTATTCTGTGGCGCTGGGTCTGG
TCCGGGACTTGTCAAAGAACGGGGTAAAAGTGGGCATTTATGACCCGTTTATACCTGCAGACCAGCTGGAGAACA
CGCTGCGTGCGAGCAATGCATCTCTTGAGACGGTCACAGTGGCCGACTCAGTGGAGACGGCATGCGCGGGATGCA
GTGCTGTTATTCTTCACACGGACTGGGAGACGTTCGGACATGAGAAGGTTCGATGGCAGGGCATTGCGGGTCAGA
TGCAGAGCCCGAAGGTGTTCTTGGATCCTTATGGTGTGTTTGACCAGTTCAAGATGCAGCAGTGGGGATTCAAGA
TGTTGCAGGTGGGTGTGAGGCAGATAGAAGCAAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail