Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6767.t1
Gene name
Locationscaffold_043:200732..201622
Strand-
Gene length (bp)890
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 2.3E-50 20 267
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 7.9E-27 24 191

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6767.t1
MSLRSHSIQHPNFHVSFPHERVVQVTLNRPQKLNSLDLATSREIQKVWELFDQDESLWVGIITGTGRAFCTGADL
QEWNAMNEAGVVNDMSPPGLAGLPRRSGKKPIIAAVNGICMGGGFEMVANCDIVIASVSAIFALPEVKRGIVPVA
GCLPRLTRTLGLQRTMDLALTGRSVDAKTLYDWGLVTRLVDIGDDVAQAALQVARVMCNNSPDALIVGREGIRLS
WEAGSVEDAVSTLAEHSYPRLVEGANFAEGIRAFVEKRSPQWINSKL*
Coding >Ani_SJS100_1|g6767.t1
ATGTCACTCCGATCGCATTCCATACAACATCCAAATTTTCATGTCTCGTTTCCCCACGAGCGTGTGGTCCAGGTG
ACCTTAAATCGCCCACAAAAGCTCAATTCTCTCGATTTGGCTACGAGTCGAGAGATCCAAAAAGTCTGGGAGCTG
TTCGACCAGGATGAGAGCTTGTGGGTGGGTATTATTACTGGTACCGGGAGAGCCTTTTGCACTGGGGCGGATCTG
CAAGAGTGGAATGCAATGAACGAAGCTGGAGTTGTCAATGACATGTCCCCGCCCGGACTAGCAGGCCTGCCCCGA
CGGAGCGGCAAGAAACCCATCATCGCAGCGGTCAACGGTATCTGCATGGGGGGCGGGTTTGAAATGGTAGCAAAC
TGTGACATCGTAATCGCCTCGGTGTCTGCCATTTTTGCGCTGCCAGAAGTCAAGCGAGGGATTGTGCCTGTGGCC
GGCTGCCTACCACGCCTGACCCGGACATTGGGGTTGCAGCGCACGATGGACCTTGCCTTGACTGGCCGCAGTGTG
GACGCAAAGACACTTTACGATTGGGGGCTGGTGACTCGGTTGGTGGATATTGGTGACGATGTTGCACAGGCAGCT
CTACAGGTCGCTCGCGTCATGTGCAATAACAGTCCGGATGCGCTCATTGTTGGCCGCGAGGGTATCCGGTTGAGC
TGGGAGGCTGGTAGCGTGGAGGATGCGGTGTCGACACTGGCGGAACACTCGTACCCGCGCCTGGTGGAGGGAGCT
AATTTTGCCGAAGGTATTCGGGCGTTTGTAGAGAAACGGTCGCCACAATGGATCAACTCCAAGTTGTGA
Transcript >Ani_SJS100_1|g6767.t1
ATGTCACTCCGATCGCATTCCATACAACATCCAAATTTTCATGTCTCGTTTCCCCACGAGCGTGTGGTCCAGGTG
ACCTTAAATCGCCCACAAAAGCTCAATTCTCTCGATTTGGCTACGAGTCGAGAGATCCAAAAAGTCTGGGAGCTG
TTCGACCAGGATGAGAGCTTGTGGGTGGGTATTATTACTGGTACCGGGAGAGCCTTTTGCACTGGGGCGGATCTG
CAAGAGTGGAATGCAATGAACGAAGCTGGAGTTGTCAATGACATGTCCCCGCCCGGACTAGCAGGCCTGCCCCGA
CGGAGCGGCAAGAAACCCATCATCGCAGCGGTCAACGGTATCTGCATGGGGGGCGGGTTTGAAATGGTAGCAAAC
TGTGACATCGTAATCGCCTCGGTGTCTGCCATTTTTGCGCTGCCAGAAGTCAAGCGAGGGATTGTGCCTGTGGCC
GGCTGCCTACCACGCCTGACCCGGACATTGGGGTTGCAGCGCACGATGGACCTTGCCTTGACTGGCCGCAGTGTG
GACGCAAAGACACTTTACGATTGGGGGCTGGTGACTCGGTTGGTGGATATTGGTGACGATGTTGCACAGGCAGCT
CTACAGGTCGCTCGCGTCATGTGCAATAACAGTCCGGATGCGCTCATTGTTGGCCGCGAGGGTATCCGGTTGAGC
TGGGAGGCTGGTAGCGTGGAGGATGCGGTGTCGACACTGGCGGAACACTCGTACCCGCGCCTGGTGGAGGGAGCT
AATTTTGCCGAAGGTATTCGGGCGTTTGTAGAGAAACGGTCGCCACAATGGATCAACTCCAAGTTGTGA
Gene >Ani_SJS100_1|g6767.t1
ATGTCACTCCGATCGCATTCCATACAACATCCAAATTTTCATGTCTCGTTTCCCCACGAGCGTGTGGTCCAGGTG
ACCTTAAATCGCCCACAAAAGCTCAATTCTCTCGATTTGGCTACGAGTCGAGAGATCCAAAAAGTCTGGGAGCTG
TTCGACCAGGATGAGAGCTTGTGGGTGGGTATTATTACTGGTACCGGGAGAGCCTTTTGCACTGGGGCGGATCTG
CAAGGTATATTCGATTTCTATGCTCTCAAAGACCTCTGTGCTATGGCATATTTGCTTACTTCTCGAGTTGCATAG
AGTGGAATGCAATGAACGAAGCTGGAGTTGTCAATGACATGTCCCCGCCCGGACTAGCAGGCCTGCCCCGACGGA
GCGGCAAGAAACCCATCATCGCAGCGGTCAACGGTATCTGCATGGGGGGCGGGTTTGAAATGGTAGCAAACTGTG
ACATCGTAATCGCCTCGGTGTCTGCCATTTTTGCGCTGCCAGAAGTCAAGCGAGGGATTGTGCCTGTGGCCGGCT
GCCTACCACGCCTGACCCGGACATTGGGGTTGCAGCGCACGATGGACCTTGCCTTGACTGGCCGCAGTGTGGACG
CAAAGACACTTTACGATTGGGGGCTGGTGACTCGGTTGGTGGATATTGGTGACGATGTTGCACAGGCAGCTCTAC
AGGTCGCTCGCGTCATGTGCAATAACAGTCCGGATGCGCTCATTGTTGGCCGCGAGGGTATCCGGTTGAGCTGGG
AGGCTGGTAGCGTGGAGGATGCGGTGTCGACACTGGCGGAACACTCGTACCCGCGCCTGGTGGAGGGAGCTAATT
TTGCCGAAGGTATTCGGGCGTTTGTAGAGAAACGGTCGCCACAATGGATCAACTCCAAGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail