Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6691.t1
Gene name
Locationscaffold_042:239630..240593
Strand-
Gene length (bp)963
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 2.1E-24 24 226
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.5E-14 31 221
PF08659 KR KR domain 3.9E-09 25 119

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6691.t1
MPIFDATATSEQVIEAFKSNIKGKTFVITGAGKPSIGSQMATSLAKAGPSHILIASRTLGKVHPVLDEIHAIDST
IKTTAVEVDLTDHESVRRAADEILAAAPKIDVLINSAGVMAIKKYTLDKQGIELQLSANHVGHFLLTNMLIPALI
SAGSARVVNLTSAGYLVSPFRFEDWNYSNGKEYDPWTGYGQAKTANILFTYGLGQRLKHKGIAAVAVHPGYNGDT
KLGSHLTWDDYAKISAVAIRNTGKEFVFEEPRFKTYTQIAATPLIAALDPELQALAPVYMQNSVVSEAAEHARDP
ASVDALWRLSEGLVGQEFRY*
Coding >Ani_SJS100_1|g6691.t1
ATGCCCATTTTCGACGCAACAGCCACCAGCGAACAGGTCATCGAAGCCTTCAAGTCTAACATCAAAGGCAAGACC
TTCGTCATCACCGGCGCCGGCAAGCCCAGTATCGGCAGCCAGATGGCTACATCTCTAGCCAAAGCCGGGCCATCA
CATATCCTCATTGCCTCACGCACCCTCGGCAAAGTTCATCCAGTGTTGGATGAGATCCACGCCATCGACAGCACC
ATCAAAACTACAGCGGTAGAGGTGGACCTGACAGATCATGAATCCGTTCGCCGCGCCGCAGACGAGATTCTCGCT
GCGGCACCCAAGATCGATGTCCTGATCAACAGTGCCGGGGTCATGGCAATCAAGAAATACACCCTCGACAAGCAG
GGGATAGAGCTACAACTCTCTGCTAATCACGTTGGCCACTTCTTACTCACCAACATGCTCATACCGGCTCTCATA
TCTGCTGGATCCGCGCGCGTGGTCAATCTAACCAGCGCCGGGTACCTCGTCTCGCCATTTCGGTTCGAAGACTGG
AACTATTCCAACGGAAAAGAATACGACCCGTGGACTGGGTACGGGCAGGCTAAAACAGCCAATATATTATTCACC
TATGGCTTAGGCCAGCGGCTAAAGCATAAGGGAATTGCAGCCGTTGCTGTTCATCCAGGCTATAATGGAGATACT
AAACTTGGCAGTCACCTTACTTGGGACGATTACGCTAAGATCTCTGCGGTTGCGATACGGAATACCGGCAAGGAG
TTTGTTTTCGAGGAGCCTCGGTTCAAAACGTATACCCAGATTGCGGCTACTCCGTTGATTGCCGCTTTGGATCCG
GAGTTGCAGGCTCTGGCGCCGGTGTACATGCAGAATAGTGTGGTTAGTGAGGCTGCGGAGCATGCTCGGGATCCT
GCGAGTGTGGATGCTTTGTGGAGGTTGAGTGAGGGGCTTGTTGGGCAGGAGTTTCGGTATTAG
Transcript >Ani_SJS100_1|g6691.t1
ATGCCCATTTTCGACGCAACAGCCACCAGCGAACAGGTCATCGAAGCCTTCAAGTCTAACATCAAAGGCAAGACC
TTCGTCATCACCGGCGCCGGCAAGCCCAGTATCGGCAGCCAGATGGCTACATCTCTAGCCAAAGCCGGGCCATCA
CATATCCTCATTGCCTCACGCACCCTCGGCAAAGTTCATCCAGTGTTGGATGAGATCCACGCCATCGACAGCACC
ATCAAAACTACAGCGGTAGAGGTGGACCTGACAGATCATGAATCCGTTCGCCGCGCCGCAGACGAGATTCTCGCT
GCGGCACCCAAGATCGATGTCCTGATCAACAGTGCCGGGGTCATGGCAATCAAGAAATACACCCTCGACAAGCAG
GGGATAGAGCTACAACTCTCTGCTAATCACGTTGGCCACTTCTTACTCACCAACATGCTCATACCGGCTCTCATA
TCTGCTGGATCCGCGCGCGTGGTCAATCTAACCAGCGCCGGGTACCTCGTCTCGCCATTTCGGTTCGAAGACTGG
AACTATTCCAACGGAAAAGAATACGACCCGTGGACTGGGTACGGGCAGGCTAAAACAGCCAATATATTATTCACC
TATGGCTTAGGCCAGCGGCTAAAGCATAAGGGAATTGCAGCCGTTGCTGTTCATCCAGGCTATAATGGAGATACT
AAACTTGGCAGTCACCTTACTTGGGACGATTACGCTAAGATCTCTGCGGTTGCGATACGGAATACCGGCAAGGAG
TTTGTTTTCGAGGAGCCTCGGTTCAAAACGTATACCCAGATTGCGGCTACTCCGTTGATTGCCGCTTTGGATCCG
GAGTTGCAGGCTCTGGCGCCGGTGTACATGCAGAATAGTGTGGTTAGTGAGGCTGCGGAGCATGCTCGGGATCCT
GCGAGTGTGGATGCTTTGTGGAGGTTGAGTGAGGGGCTTGTTGGGCAGGAGTTTCGGTATTAG
Gene >Ani_SJS100_1|g6691.t1
ATGCCCATTTTCGACGCAACAGCCACCAGCGAACAGGTCATCGAAGCCTTCAAGTCTAACATCAAAGGCAAGACC
TTCGTCATCACCGGCGCCGGCAAGCCCAGTATCGGCAGCCAGATGGCTACATCTCTAGCCAAAGCCGGGCCATCA
CATATCCTCATTGCCTCACGCACCCTCGGCAAAGTTCATCCAGTGTTGGATGAGATCCACGCCATCGACAGCACC
ATCAAAACTACAGCGGTAGAGGTGGACCTGACAGATCATGAATCCGTTCGCCGCGCCGCAGACGAGATTCTCGCT
GCGGCACCCAAGATCGATGTCCTGATCAACAGTGCCGGGGTCATGGCAATCAAGAAATACACCCTCGACAAGCAG
GGGATAGAGCTACAACTCTCTGCTAATCACGTTGGCCACTTCTTACTCACCAACATGCTCATACCGGCTCTCATA
TCTGCTGGATCCGCGCGCGTGGTCAATCTAACCAGCGCCGGGTACCTCGTCTCGCCATTTCGGTTCGAAGACTGG
AACTATTCCAACGGAAAAGAATACGACCCGTGGACTGGGTACGGGCAGGCTAAAACAGCCAATATATTATTCACC
TATGGCTTAGGCCAGCGGCTAAAGCATAAGGGAATTGCAGCCGTTGCTGTTCATCCAGGCTATAATGGAGATACT
AAACTTGGCAGTCACCTTACTTGGGACGATTACGCTAAGATCTCTGCGGTTGCGATACGGAATACCGGCAAGGAG
TTTGTTTTCGAGGAGCCTCGGTTCAAAACGTATACCCAGATTGCGGCTACTCCGTTGATTGCCGCTTTGGATCCG
GAGTTGCAGGCTCTGGCGCCGGTGTACATGCAGAATAGTGTGGTTAGTGAGGCTGCGGAGCATGCTCGGGATCCT
GCGAGTGTGGATGCTTTGTGGAGGTTGAGTGAGGGGCTTGTTGGGCAGGAGTTTCGGTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail