Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6571.t1
Gene name
Locationscaffold_041:170593..171891
Strand+
Gene length (bp)1298
Transcript length (bp)1104
Coding sequence length (bp)1104
Protein length (aa) 368

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03239 FTR1 Iron permease FTR1 family 9.2E-86 9 321

GO

GO Term Description Terminal node
GO:0033573 high-affinity iron permease complex Yes
GO:0034755 iron ion transmembrane transport Yes
GO:0016020 membrane Yes
GO:0005381 iron ion transmembrane transporter activity Yes
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0009987 cellular process No
GO:0006826 iron ion transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0008324 cation transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0032991 protein-containing complex No
GO:1902494 catalytic complex No
GO:0098660 inorganic ion transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0098655 cation transmembrane transport No
GO:0098796 membrane protein complex No
GO:0030001 metal ion transport No
GO:0008150 biological_process No
GO:0055085 transmembrane transport No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0006811 ion transport No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:1990204 oxidoreductase complex No
GO:0098797 plasma membrane protein complex No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:1902495 transmembrane transporter complex No
GO:0051234 establishment of localization No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0015075 ion transmembrane transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:1990351 transporter complex No
GO:1905862 ferroxidase complex No
GO:0000041 transition metal ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 52 74 22
3 89 111 22
4 148 170 22
5 180 202 22
6 209 231 22
7 292 314 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6571.t1
MANKVFAVTVFFICFRECLESVIIVSVLLSFLKQTLGGEGDVKTLKRLNRHVWCGVALGLFICLWVGGGMIGAFY
GLNKDVFTGSEDIWEGIFGFIASIIISIMGAGLLRVSKLQDKWRDKLAQALEEKEKTKIGIYQRFKDWSKKYVMF
LLPFVTVLREGLEAVVYVGGVGLGLPATSFPLAVVCGLAAGIAVGYLLYRCGNTASLQYFLIISTCFLYLVSAGL
FSRAIWYLQNNAWNNIIGGDASETGSGAGSYDIRQSVWHVNCCNPELGSGGGWGIFNALFGWTNSATYGSVLGYN
LYWICIITGYVCMWYNERYGYIPFFSACMRRIRPKKAASRSSSEGVIEKSKEVDMMPSQIVTREVNA*
Coding >Ani_SJS100_1|g6571.t1
ATGGCCAACAAGGTATTTGCAGTGACGGTGTTCTTCATCTGCTTTCGTGAATGTCTCGAGAGTGTCATTATCGTG
TCCGTGCTTCTGTCTTTCCTGAAGCAGACACTAGGAGGAGAAGGCGACGTAAAAACATTAAAACGATTAAATCGA
CATGTATGGTGTGGTGTGGCATTAGGTCTTTTCATATGTCTCTGGGTCGGTGGTGGTATGATTGGTGCCTTCTAC
GGCCTCAACAAGGATGTCTTCACCGGTAGTGAGGATATCTGGGAAGGTATCTTCGGTTTCATCGCTTCTATCATT
ATCAGTATCATGGGTGCTGGTCTTCTGCGTGTCTCCAAGCTGCAGGACAAGTGGCGCGACAAGCTGGCCCAGGCT
CTCGAAGAGAAAGAGAAGACCAAGATCGGTATCTACCAGCGGTTCAAAGACTGGTCCAAGAAATATGTCATGTTC
CTTCTTCCGTTCGTGACTGTTCTTCGTGAGGGTCTTGAAGCCGTCGTGTATGTTGGTGGTGTCGGTCTTGGTCTC
CCTGCGACTTCGTTCCCTCTCGCCGTCGTTTGTGGTCTTGCTGCTGGTATTGCTGTCGGATATCTTCTGTACAGA
TGTGGTAACACCGCCTCTCTGCAATATTTCCTGATCATCTCGACCTGCTTCCTTTACCTCGTCTCCGCTGGTCTC
TTCTCCCGTGCCATCTGGTACCTCCAGAACAACGCCTGGAACAACATCATCGGTGGTGACGCCTCCGAAACGGGT
TCTGGAGCCGGTTCTTACGATATTCGCCAGAGTGTCTGGCACGTCAACTGCTGTAACCCCGAACTGGGCAGCGGT
GGCGGATGGGGTATCTTCAACGCTCTTTTCGGTTGGACCAACTCTGCCACCTATGGATCCGTGCTGGGATACAAC
CTGTACTGGATCTGCATCATCACCGGCTATGTTTGCATGTGGTACAATGAGCGCTACGGATACATTCCGTTCTTT
TCTGCCTGCATGCGTAGAATCCGCCCCAAAAAGGCTGCCAGTCGGTCCAGCAGTGAGGGGGTGATCGAGAAGAGC
AAGGAGGTCGATATGATGCCCTCGCAGATTGTTACCAGAGAAGTCAACGCCTGA
Transcript >Ani_SJS100_1|g6571.t1
ATGGCCAACAAGGTATTTGCAGTGACGGTGTTCTTCATCTGCTTTCGTGAATGTCTCGAGAGTGTCATTATCGTG
TCCGTGCTTCTGTCTTTCCTGAAGCAGACACTAGGAGGAGAAGGCGACGTAAAAACATTAAAACGATTAAATCGA
CATGTATGGTGTGGTGTGGCATTAGGTCTTTTCATATGTCTCTGGGTCGGTGGTGGTATGATTGGTGCCTTCTAC
GGCCTCAACAAGGATGTCTTCACCGGTAGTGAGGATATCTGGGAAGGTATCTTCGGTTTCATCGCTTCTATCATT
ATCAGTATCATGGGTGCTGGTCTTCTGCGTGTCTCCAAGCTGCAGGACAAGTGGCGCGACAAGCTGGCCCAGGCT
CTCGAAGAGAAAGAGAAGACCAAGATCGGTATCTACCAGCGGTTCAAAGACTGGTCCAAGAAATATGTCATGTTC
CTTCTTCCGTTCGTGACTGTTCTTCGTGAGGGTCTTGAAGCCGTCGTGTATGTTGGTGGTGTCGGTCTTGGTCTC
CCTGCGACTTCGTTCCCTCTCGCCGTCGTTTGTGGTCTTGCTGCTGGTATTGCTGTCGGATATCTTCTGTACAGA
TGTGGTAACACCGCCTCTCTGCAATATTTCCTGATCATCTCGACCTGCTTCCTTTACCTCGTCTCCGCTGGTCTC
TTCTCCCGTGCCATCTGGTACCTCCAGAACAACGCCTGGAACAACATCATCGGTGGTGACGCCTCCGAAACGGGT
TCTGGAGCCGGTTCTTACGATATTCGCCAGAGTGTCTGGCACGTCAACTGCTGTAACCCCGAACTGGGCAGCGGT
GGCGGATGGGGTATCTTCAACGCTCTTTTCGGTTGGACCAACTCTGCCACCTATGGATCCGTGCTGGGATACAAC
CTGTACTGGATCTGCATCATCACCGGCTATGTTTGCATGTGGTACAATGAGCGCTACGGATACATTCCGTTCTTT
TCTGCCTGCATGCGTAGAATCCGCCCCAAAAAGGCTGCCAGTCGGTCCAGCAGTGAGGGGGTGATCGAGAAGAGC
AAGGAGGTCGATATGATGCCCTCGCAGATTGTTACCAGAGAAGTCAACGCCTGA
Gene >Ani_SJS100_1|g6571.t1
ATGGCCAACAAGGTATTTGCAGTGACGGGTATGATTCCTCTGACTCTTGCAACCCAGTATTGCAAGGCATTCGCT
CCCCGATCCAGTGCTCACACTCTACAGTGTTCTTCATCTGCTTTCGTGAATGTCTCGAGAGTGTCATTATCGTGT
CCGTGCTTCTGTCTTTCCTGAAGCAGACACTAGGAGGAGAAGGCGACGTAAAAACATTAAAACGATTAAATCGAC
ATGTACGTTTCCTTCCTTCCCCATACAGACGTCTTTTCTCCCCTCTTACACGATCCAGGTATGGTGTGGTGTGGC
ATTAGGTCTTTTCATATGTCTCTGGGTCGGTGGTGGTATGATTGGTGCCTTCTACGGCCTCAACAAGGATGTCTT
CACCGGTAGTGAGGATATCTGGGAAGGTATCTTCGGTTTCATCGCTTCTATCATTATCAGTATCATGGGTGCTGG
TCTTCTGCGTGTCTCCAAGCTGCAGGACAAGTGGCGCGACAAGCTGGCCCAGGCTCTCGAAGAGAAAGAGAAGAC
CAAGATCGGTATCTACCAGCGGTTCAAAGACTGGTCCAAGAAATATGTCATGTTCCTTCTTCCGTTCGTGACTGT
TCTTCGTGAGGGTCTTGAAGCCGTCGTGTATGTTGGTGGTGTCGGTCTTGGTCTCCCTGCGACTTCGTTCCCTCT
CGCCGTCGTTTGTGGTCTTGCTGCTGGTATTGCTGTCGGATATCTTCTGTACAGGTTAGTTTCTCCCCTCGTGTT
AAGAGGCTCTTGCAGCCCAGACTAACATCCTCCCCTTAACTAGATGTGGTAACACCGCCTCTCTGCAATATTTCC
TGATCATCTCGACCTGCTTCCTTTACCTCGTCTCCGCTGGTCTCTTCTCCCGTGCCATCTGGTACCTCCAGAACA
ACGCCTGGAACAACATCATCGGTGGTGACGCCTCCGAAACGGGTTCTGGAGCCGGTTCTTACGATATTCGCCAGA
GTGTCTGGCACGTCAACTGCTGTAACCCCGAACTGGGCAGCGGTGGCGGATGGGGTATCTTCAACGCTCTTTTCG
GTTGGACCAACTCTGCCACCTATGGATCCGTGCTGGGATACAACCTGTACTGGATCTGCATCATCACCGGCTATG
TTTGCATGTGGTACAATGAGCGCTACGGATACATTCCGTTCTTTTCTGCCTGCATGCGTAGAATCCGCCCCAAAA
AGGCTGCCAGTCGGTCCAGCAGTGAGGGGGTGATCGAGAAGAGCAAGGAGGTCGATATGATGCCCTCGCAGATTG
TTACCAGAGAAGTCAACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail