Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6485.t1
Gene name
Locationscaffold_040:204031..205655
Strand-
Gene length (bp)1624
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.7E-32 65 400

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 97 119 22
2 126 143 17
3 153 175 22
4 187 209 22
5 219 241 22
6 292 314 22
7 324 346 22
8 353 372 19
9 382 404 22
10 416 438 22
11 448 470 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6485.t1
MIAQASDPPPKAPKPVTRDSITDDASHINRYGSVPGVVEDVVQVIDHKAERALCRRFDFRILPVLALMYLFNALD
KGNLSNAETAGMSDDLNFKPGQYNLLLSIFYVPYVIFAPPFAMLGKRWSPARVLPVLMFSFGSFTLLSSATKNFG
GMFALRWFLGTSEAAFFPLVIYYLTTFYRRAELARRLAIFYAASNIANAFSGLLAFGVFQIKDSSLPDWRYLFIL
EGGVTVLFSCFAFWYLPRSASTASFLSEDEKLLAHHRIQVDSSAIVDEPFRLRSALGIFSHPSTYAFLAIEICLG
VPLQGVSLFMPQIIQRLGFSTVKTNLYTVAPNVTGAAMLIILAFASDAVRLRAPFIVLGFLLTFTGFMIYAAIDD
VDRQIHLAYFATFMMTWGTSAPSVLLSTWYNNNIADENKRVLLTSIGVPLANLMGLVSSNVFREKDKPKYLPALV
TVGAFGGTGAILASLLGVYMLLDNRRRDRKEGVRMRAQDVPTERLRDGPGAVGFRWFL*
Coding >Ani_SJS100_1|g6485.t1
ATGATCGCCCAAGCCTCGGATCCGCCCCCGAAAGCCCCAAAGCCGGTTACACGCGACTCGATCACCGACGATGCT
TCCCACATCAACCGCTACGGCTCTGTCCCGGGGGTCGTCGAGGATGTCGTCCAGGTCATTGACCACAAGGCCGAA
CGGGCTCTCTGTCGTCGCTTCGACTTTCGTATACTTCCGGTGCTCGCATTAATGTATCTCTTCAATGCCCTGGAC
AAAGGCAACCTCAGTAATGCTGAAACTGCCGGCATGAGCGACGATCTCAATTTCAAACCCGGGCAATACAACCTT
CTCCTCTCCATCTTTTACGTCCCATATGTCATCTTCGCGCCTCCCTTCGCTATGCTCGGCAAACGTTGGAGTCCC
GCCCGCGTACTCCCCGTCCTTATGTTCTCCTTTGGTTCCTTCACGCTGCTGTCGTCCGCGACCAAGAATTTCGGT
GGCATGTTCGCTCTGCGCTGGTTCCTCGGCACGTCCGAAGCGGCCTTCTTCCCACTAGTCATCTACTACCTCACA
ACCTTCTACCGGCGTGCCGAGCTCGCCCGTCGGCTTGCCATCTTCTACGCAGCCAGCAACATTGCCAATGCCTTC
TCCGGCCTACTCGCCTTTGGTGTCTTCCAAATCAAAGACTCCTCGCTCCCGGACTGGCGGTACCTGTTCATCCTT
GAAGGTGGTGTCACCGTCCTCTTCTCCTGCTTCGCGTTCTGGTACCTCCCGCGGTCTGCTTCGACAGCGTCCTTC
CTCAGCGAAGACGAGAAGCTCCTCGCCCACCACCGCATCCAAGTCGACAGTTCCGCCATCGTCGACGAGCCGTTC
CGCCTCCGCTCCGCTCTCGGTATCTTTTCCCACCCCTCCACATATGCCTTCCTCGCCATTGAAATCTGTCTCGGT
GTGCCCCTGCAGGGCGTCTCCCTCTTCATGCCCCAGATCATCCAACGTCTGGGCTTCTCCACCGTCAAAACAAAC
CTCTACACAGTGGCCCCTAACGTCACCGGAGCAGCCATGCTCATTATTCTCGCCTTCGCATCCGATGCCGTCCGC
CTTCGTGCCCCATTCATCGTCCTAGGCTTCCTCCTCACCTTCACGGGCTTCATGATCTATGCCGCTATCGATGAC
GTCGATCGCCAGATCCACTTAGCGTACTTTGCCACCTTCATGATGACCTGGGGGACCTCCGCACCGTCCGTGCTG
CTCTCCACCTGGTACAACAACAACATTGCAGACGAGAACAAGCGTGTGCTGCTGACGAGTATCGGCGTGCCGTTG
GCGAACTTGATGGGCCTGGTGTCGAGCAATGTCTTCCGGGAGAAGGATAAGCCAAAGTACCTGCCTGCCCTCGTA
ACGGTGGGTGCATTCGGAGGTACGGGTGCTATTCTGGCCTCGCTATTGGGCGTCTATATGCTTTTGGATAATCGA
AGGAGGGATCGTAAAGAGGGAGTCAGGATGCGGGCGCAGGATGTCCCAACTGAAAGGTTGCGCGATGGGCCGGGG
GCTGTTGGGTTCCGGTGGTTCTTATGA
Transcript >Ani_SJS100_1|g6485.t1
ATGATCGCCCAAGCCTCGGATCCGCCCCCGAAAGCCCCAAAGCCGGTTACACGCGACTCGATCACCGACGATGCT
TCCCACATCAACCGCTACGGCTCTGTCCCGGGGGTCGTCGAGGATGTCGTCCAGGTCATTGACCACAAGGCCGAA
CGGGCTCTCTGTCGTCGCTTCGACTTTCGTATACTTCCGGTGCTCGCATTAATGTATCTCTTCAATGCCCTGGAC
AAAGGCAACCTCAGTAATGCTGAAACTGCCGGCATGAGCGACGATCTCAATTTCAAACCCGGGCAATACAACCTT
CTCCTCTCCATCTTTTACGTCCCATATGTCATCTTCGCGCCTCCCTTCGCTATGCTCGGCAAACGTTGGAGTCCC
GCCCGCGTACTCCCCGTCCTTATGTTCTCCTTTGGTTCCTTCACGCTGCTGTCGTCCGCGACCAAGAATTTCGGT
GGCATGTTCGCTCTGCGCTGGTTCCTCGGCACGTCCGAAGCGGCCTTCTTCCCACTAGTCATCTACTACCTCACA
ACCTTCTACCGGCGTGCCGAGCTCGCCCGTCGGCTTGCCATCTTCTACGCAGCCAGCAACATTGCCAATGCCTTC
TCCGGCCTACTCGCCTTTGGTGTCTTCCAAATCAAAGACTCCTCGCTCCCGGACTGGCGGTACCTGTTCATCCTT
GAAGGTGGTGTCACCGTCCTCTTCTCCTGCTTCGCGTTCTGGTACCTCCCGCGGTCTGCTTCGACAGCGTCCTTC
CTCAGCGAAGACGAGAAGCTCCTCGCCCACCACCGCATCCAAGTCGACAGTTCCGCCATCGTCGACGAGCCGTTC
CGCCTCCGCTCCGCTCTCGGTATCTTTTCCCACCCCTCCACATATGCCTTCCTCGCCATTGAAATCTGTCTCGGT
GTGCCCCTGCAGGGCGTCTCCCTCTTCATGCCCCAGATCATCCAACGTCTGGGCTTCTCCACCGTCAAAACAAAC
CTCTACACAGTGGCCCCTAACGTCACCGGAGCAGCCATGCTCATTATTCTCGCCTTCGCATCCGATGCCGTCCGC
CTTCGTGCCCCATTCATCGTCCTAGGCTTCCTCCTCACCTTCACGGGCTTCATGATCTATGCCGCTATCGATGAC
GTCGATCGCCAGATCCACTTAGCGTACTTTGCCACCTTCATGATGACCTGGGGGACCTCCGCACCGTCCGTGCTG
CTCTCCACCTGGTACAACAACAACATTGCAGACGAGAACAAGCGTGTGCTGCTGACGAGTATCGGCGTGCCGTTG
GCGAACTTGATGGGCCTGGTGTCGAGCAATGTCTTCCGGGAGAAGGATAAGCCAAAGTACCTGCCTGCCCTCGTA
ACGGTGGGTGCATTCGGAGGTACGGGTGCTATTCTGGCCTCGCTATTGGGCGTCTATATGCTTTTGGATAATCGA
AGGAGGGATCGTAAAGAGGGAGTCAGGATGCGGGCGCAGGATGTCCCAACTGAAAGGTTGCGCGATGGGCCGGGG
GCTGTTGGGTTCCGGTGGTTCTTATGA
Gene >Ani_SJS100_1|g6485.t1
ATGATCGCCCAAGCCTCGGATCCGCCCCCGAAAGCCCCAAAGCCGGTTACACGCGACTCGATCACCGACGATGCT
TCCCACATCAACCGCTACGGCTCTGTCCCGGGGGTCGTCGAGGATGTCGTCCAGGTCATTGACCACAAGGCCGAA
CGGGCTCTCTGTCGTCGCTTCGACTTTCGTATACTTCCGGTGCTCGCATTAATGTGTGCGTGTTGTCCATCCCAT
CCATCTCACCACCTGCTAATAGTTATAGATCTCTTCAATGCCCTGGACAAAGGCAACCTCAGTAATGCTGAAACT
GCCGGCATGAGCGACGGTAACCTATCCCTCTCTCTCTGTGTATCGTTCATTGCTAACATCACCAGATCTCAATTT
CAAACCCGGGCAATACAACCTTCTCCTCTCCATCTTTTACGTCCCATATGTCATCTTCGCGCCTCCCTTCGCTAT
GCTCGGCAAACGTTGGAGTCCCGCCCGCGTACTCCCCGTCCTTATGTTCTCCTTTGGTTCCTTCACGCTGCTGTC
GTCCGCGACCAAGAATTTCGGTGGCATGTTCGCTCTGCGCTGGTTCCTCGGCACGTCCGAAGCGGCCTTCTTCCC
ACTAGTCATCTACTACCTCACAACCTTCTACCGGCGTGCCGAGCTCGCCCGTCGGCTTGCCATCTTCTACGCAGC
CAGCAACATTGCCAATGCCTTCTCCGGCCTACTCGCCTTTGGTGTCTTCCAAATCAAAGACTCCTCGCTCCCGGA
CTGGCGGTACCTGTTCATCCTTGAAGGTGGTGTCACCGTCCTCTTCTCCTGCTTCGCGTTCTGGTACCTCCCGCG
GTCTGCTTCGACAGCGTCCTTCCTCAGCGAAGACGAGAAGCTCCTCGCCCACCACCGCATCCAAGTCGACAGTTC
CGCCATCGTCGACGAGCCGTTCCGCCTCCGCTCCGCTCTCGGTATCTTTTCCCACCCCTCCACATATGCCTTCCT
CGCCATTGAAATCTGTCTCGGTGTGCCCCTGCAGGGCGTCTCCCTCTTCATGCCCCAGATCATCCAACGTCTGGG
CTTCTCCACCGTCAAAACAAACCTCTACACAGTGGCCCCTAACGTCACCGGAGCAGCCATGCTCATTATTCTCGC
CTTCGCATCCGATGCCGTCCGCCTTCGTGCCCCATTCATCGTCCTAGGCTTCCTCCTCACCTTCACGGGCTTCAT
GATCTATGCCGCTATCGATGACGTCGATCGCCAGATCCACTTAGCGTACTTTGCCACCTTCATGATGACCTGGGG
GACCTCCGCACCGTCCGTGCTGCTCTCCACCTGGTACAACAACAACATTGCAGACGAGAACAAGCGTGTGCTGCT
GACGAGTATCGGCGTGCCGTTGGCGAACTTGATGGGCCTGGTGTCGAGCAATGTCTTCCGGGAGAAGGATAAGCC
AAAGTACCTGCCTGCCCTCGTAACGGTGGGTGCATTCGGAGGTACGGGTGCTATTCTGGCCTCGCTATTGGGCGT
CTATATGCTTTTGGATAATCGAAGGAGGGATCGTAAAGAGGGAGTCAGGATGCGGGCGCAGGATGTCCCAACTGA
AAGGTTGCGCGATGGGCCGGGGGCTGTTGGGTTCCGGTGGTTCTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail