Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6480.t1
Gene name
Locationscaffold_040:182497..187484
Strand+
Gene length (bp)4987
Transcript length (bp)4854
Coding sequence length (bp)4854
Protein length (aa) 1618

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18325 Fas_alpha_ACP Fatty acid synthase subunit alpha Acyl carrier domain 3.3E-65 146 307
PF18314 FAS_I_H Fatty acid synthase type I helical domain 3.3E-37 334 518
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 3.0E-20 1071 1280
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 6.5E-12 1414 1503

GO

GO Term Description Terminal node
GO:0008897 holo-[acyl-carrier-protein] synthase activity Yes
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6480.t1
MAADMDTQRKLARILLIELMAYQFASPVQWIETQDVILSRRECDKIVEIGPTPTLAGMFQRTLNSKYQTQECTRS
TPRRLLNSEKDTQEVYFEDRPGAPDAKLKERTKNAANTATIPSPVKTEVAPVAQPETVSAPKPKPTTIEIEDEGV
KAQLIVTAIVSRALKKSPSDVDWTKTIKVLAGGRSTLENEVVGDLHAEFGTLPERVEETPLAELWQAIQPSHSGM
LGKVSTGMINSLFTSKLPSGFTTAAARDRLKSQWGLKQGRQDSCLLLATTEAPPTRISSESDAKTFIDGVVESYA
SKNSIPLHTSHPSADGASASNIMVDPEALRAMSEAQKAVSRQLLNIYASQLGLDLGADRRSLDALQHDIKTGMQS
ELGLWTEEHGEDYANGIKPRFDSRKVRMYDSAWNWGRQRLLELFDLVTPVQRGDEVTLDQGNVLEACYAIANAAD
ETLLHVINEILAKLGNSAVPRPIFTDLKALCKHVLEFGPLFKGSPKQMAPFTTIDKDGTIRYFEKEREDRITFAQ
LASPTSEADAHPFIHLREKRGDAWYYSRILTAKFQNALSLVHDRGSSFNGQTVLMTGAGIGSIGAAMIRHFLQGG
ARVVVTTSSLSPEVAKVYQSIYMDHGAKGSQLIVVPFNQASVKDVNSLIEYVYSQGGLGCDIDYFIPFAALSEAG
RRLDSIDSKSELAHRLMLTNVLRLLGTIKTCKEKHRCHTNPTHVILPLSPNHGTIGGDGLYGESKLGLETLFNRW
HSEDWQDYLSICGAVIGWTRGTGLMNQNDLIAEGIEAAGMRTFSQEEMAYALVCLCVQEMTELCQERPLYADLTG
RMAEVQGLGEKLQALRQELKERSEIQAALLAESILEQQCSTAGHSSRPSTGSDRLEQRAHVRLDFPKPLDYDRDI
RTISSDLQGMVDLDRTVVVTGFSELGPVGNARTRWEMEAYGQFSLEGAIELAWLMGYISHFAGTIDGAPYSGWVD
TTTKKPVADIDVKSIYEERILNHTGIRLIESERKPFLHEITLQQDLEPLDMPESLAEQMKLEHGEFAAVQQSTTP
DLFTVQLRKGARLYIPRAMQSTRTVAGLIPDGWDPRVYGIPEEIVSQVDRVTLFTLVCTVEALLSSGITDPYELY
QYIHVSEVGTCIGSGLGGATSLNKMFNGRQSTHDIPKDILQETFINTTGAWVNMLLLSASGPLRTPVGACATAIE
SLELGYDTIVTGKAQFCLVGGCDDFTTETSQEFANMKATSNVEEEIAKGRAPHEMSRPTTSTRSGFVESQGSGLQ
VLTTAALALRMGLPIRGIIAFTSTSSDKAGRSVPAPGKGVLTNARHIPSRVPSPLMNIRNRRKRLDFRLRQIAEA
RDVALQDLDFEVAAVVAQSSTVDVEAYVNERRQQIAADFAREQKDARFNLGNDFWRNEPNIAPLAGALATWGLTI
DDLDVASFHGTSTVMNDKNESSVIHQQLSSMGRRKGNLILSVFQKSLTGHSKGAAGAWMLNGALQMLDSGLVPGN
RNADNIDPKLEEFADLIAYVQRPIRVPDIKAVSVTSFGFGQKGAQALCVHPRYLFATLGREEYDTYLDRCTKRKT
KADMFFYEGMNGNSLFRAKSAPPFAPSEETKTYLDPTVRFTC*
Coding >Ani_SJS100_1|g6480.t1
ATGGCTGCCGATATGGATACCCAGCGCAAGCTGGCTCGCATACTGCTCATTGAGCTCATGGCATACCAATTTGCC
TCCCCAGTACAATGGATTGAAACGCAGGACGTAATCCTCTCTCGCAGGGAGTGCGACAAGATCGTCGAAATCGGG
CCCACTCCGACACTCGCGGGCATGTTTCAGCGAACCCTCAACAGCAAGTACCAGACTCAGGAGTGTACTAGATCT
ACACCTCGACGACTCTTGAATTCGGAGAAGGACACCCAAGAAGTCTATTTCGAAGACCGCCCTGGTGCCCCTGAT
GCTAAACTGAAGGAAAGGACAAAGAACGCAGCAAATACAGCTACCATACCATCACCTGTCAAAACAGAAGTGGCT
CCTGTAGCGCAACCAGAGACTGTATCGGCTCCGAAACCGAAGCCGACAACAATAGAAATTGAGGACGAAGGGGTA
AAGGCACAGCTGATTGTGACCGCGATAGTGTCACGAGCGCTTAAGAAGTCGCCGTCCGATGTTGACTGGACTAAG
ACTATCAAAGTTCTTGCTGGTGGGCGCTCAACGTTGGAAAATGAGGTTGTTGGAGATCTCCATGCAGAATTCGGC
ACGCTCCCAGAACGCGTCGAAGAGACACCTCTGGCTGAATTGTGGCAGGCGATCCAGCCAAGCCATAGCGGAATG
CTTGGGAAGGTTTCCACAGGCATGATTAATTCGCTTTTCACTTCCAAATTACCCAGTGGCTTCACCACCGCCGCC
GCGCGAGATCGACTCAAATCCCAGTGGGGTCTCAAACAAGGAAGACAGGATTCCTGTTTACTCCTTGCGACAACA
GAGGCACCTCCAACACGAATTTCATCCGAATCCGACGCAAAGACCTTTATTGATGGCGTCGTGGAGAGCTATGCT
TCGAAAAATAGTATACCTTTACACACATCTCATCCGTCTGCGGACGGAGCCTCGGCTTCTAATATCATGGTCGAT
CCTGAAGCGCTTAGAGCGATGTCTGAGGCCCAGAAAGCGGTGTCAAGACAGCTCCTTAATATTTATGCATCTCAG
CTCGGCCTGGACCTAGGCGCGGATCGACGTTCATTAGACGCTCTCCAACACGACATCAAGACCGGAATGCAATCA
GAGTTGGGTCTCTGGACGGAGGAGCATGGGGAAGACTACGCCAACGGTATTAAGCCACGTTTTGATTCCCGCAAG
GTCCGCATGTATGATTCGGCATGGAATTGGGGCCGTCAGAGGCTTCTCGAGCTGTTCGATCTAGTGACTCCAGTG
CAGCGTGGGGACGAAGTCACACTCGACCAAGGGAATGTCCTTGAAGCCTGCTACGCAATTGCCAACGCGGCAGAT
GAGACGCTCCTCCATGTAATCAATGAGATACTGGCCAAGCTAGGAAATTCTGCAGTTCCGCGCCCCATCTTTACT
GATCTAAAGGCTCTGTGCAAGCATGTGCTGGAGTTCGGGCCACTTTTCAAAGGATCCCCCAAGCAGATGGCGCCA
TTCACAACTATCGACAAGGACGGGACGATACGATATTTTGAGAAGGAACGTGAAGATAGAATTACTTTTGCCCAG
TTGGCATCGCCGACATCCGAAGCCGATGCTCATCCCTTTATCCACCTCAGAGAAAAAAGGGGAGATGCATGGTAC
TACAGTCGCATATTGACCGCAAAATTTCAAAATGCGCTCAGCTTGGTGCACGACCGGGGTTCGTCCTTCAATGGG
CAGACTGTGCTGATGACGGGAGCGGGGATTGGTTCAATCGGAGCTGCGATGATTCGACACTTCCTACAGGGGGGA
GCCAGAGTCGTTGTCACAACATCCTCTCTGTCCCCTGAGGTGGCCAAGGTATATCAGAGTATCTACATGGACCAC
GGTGCCAAGGGCTCTCAACTCATTGTTGTCCCATTCAACCAAGCCAGTGTTAAGGACGTCAATTCGTTGATTGAG
TACGTCTATTCACAAGGTGGTCTTGGCTGTGACATAGATTACTTTATCCCTTTTGCTGCACTTAGTGAGGCTGGA
CGACGACTCGACTCCATTGACTCTAAATCAGAGCTCGCCCACCGTTTGATGCTCACAAACGTGCTACGTTTGCTG
GGCACCATCAAGACCTGCAAGGAAAAGCACCGTTGTCATACCAACCCCACCCATGTCATCTTGCCTCTGTCTCCC
AACCATGGAACCATTGGTGGGGATGGCCTATACGGTGAGTCAAAATTGGGCCTAGAGACGCTGTTCAACCGGTGG
CATTCGGAGGATTGGCAGGACTACCTGTCCATCTGCGGTGCCGTCATCGGTTGGACAAGAGGAACCGGTCTAATG
AACCAGAATGATCTCATCGCAGAGGGCATCGAGGCGGCTGGCATGCGGACCTTTTCTCAGGAGGAGATGGCCTAT
GCTCTGGTCTGCCTATGTGTGCAGGAAATGACTGAGCTATGTCAGGAGAGGCCTCTTTACGCAGACCTAACGGGC
CGAATGGCAGAGGTGCAGGGACTCGGAGAAAAGCTGCAAGCGTTGCGTCAGGAGCTCAAGGAAAGAAGCGAAATA
CAAGCTGCGCTTCTCGCAGAGTCGATACTAGAGCAGCAATGCTCGACTGCCGGCCATTCTTCCCGACCGAGCACC
GGCTCGGACCGACTCGAGCAGAGAGCGCATGTGCGTTTAGACTTCCCCAAGCCGCTTGACTACGATCGGGATATC
CGCACTATTAGCTCAGACCTCCAGGGAATGGTGGACTTGGATCGAACCGTAGTGGTGACGGGGTTCTCGGAGTTA
GGGCCCGTGGGCAATGCTCGCACACGATGGGAGATGGAGGCATATGGCCAATTCTCCCTCGAGGGCGCCATTGAA
CTAGCCTGGCTCATGGGATACATCAGCCACTTCGCCGGAACCATCGATGGAGCTCCCTACTCCGGGTGGGTAGAC
ACTACGACAAAAAAGCCCGTTGCCGATATCGATGTGAAGTCAATCTACGAGGAAAGGATCTTGAATCATACCGGA
ATACGTCTAATCGAGTCAGAACGAAAGCCTTTCCTGCACGAGATTACATTGCAACAAGATTTGGAACCCCTCGAT
ATGCCTGAGTCGCTCGCCGAGCAGATGAAATTGGAACATGGAGAGTTCGCTGCAGTTCAACAATCGACAACACCG
GATCTATTCACAGTACAGCTTCGCAAAGGCGCTAGACTCTATATCCCTCGCGCAATGCAATCAACTCGGACCGTC
GCCGGACTCATACCGGATGGCTGGGATCCACGTGTTTATGGAATCCCCGAGGAAATTGTGTCTCAGGTCGACCGG
GTTACGCTCTTCACACTGGTGTGTACGGTTGAAGCGCTGCTGTCCTCTGGGATTACAGATCCGTATGAACTCTAT
CAGTATATCCACGTGTCCGAAGTAGGCACATGTATCGGTTCAGGGCTTGGAGGTGCCACTTCTCTGAACAAAATG
TTCAATGGGCGCCAAAGCACTCACGACATCCCGAAGGATATCCTACAAGAGACCTTCATCAATACCACAGGAGCT
TGGGTCAATATGCTTCTACTCTCGGCAAGTGGACCTCTTCGCACCCCAGTCGGGGCGTGTGCCACTGCTATCGAG
TCCCTAGAATTAGGGTATGATACTATCGTTACCGGTAAAGCTCAGTTCTGCTTGGTCGGCGGCTGTGATGATTTC
ACGACAGAGACCTCTCAGGAGTTTGCCAACATGAAGGCGACTAGCAACGTTGAGGAAGAAATCGCCAAAGGTCGA
GCTCCTCACGAAATGTCCCGACCGACCACCAGCACCCGCAGCGGCTTTGTGGAATCTCAGGGTTCCGGACTCCAG
GTGCTCACAACGGCGGCACTGGCGCTGAGAATGGGATTGCCGATTCGAGGCATCATTGCTTTTACCAGCACATCT
AGCGATAAGGCTGGCCGCTCGGTGCCAGCTCCTGGGAAGGGGGTACTTACCAACGCCAGGCACATTCCCTCAAGG
GTACCATCGCCTCTCATGAACATCCGCAATCGCCGGAAGCGGTTGGACTTCCGCCTCCGCCAGATTGCAGAAGCG
CGGGACGTGGCCTTGCAAGATCTCGACTTCGAAGTGGCTGCGGTGGTAGCCCAGAGCTCGACTGTGGATGTTGAG
GCCTACGTCAATGAGCGTCGGCAGCAGATAGCGGCTGACTTTGCTCGCGAGCAAAAGGATGCCCGCTTCAATCTC
GGCAACGACTTCTGGCGCAACGAGCCTAATATCGCACCACTTGCCGGCGCTCTAGCTACGTGGGGGCTCACCATC
GATGATCTGGATGTGGCATCCTTCCATGGCACGTCGACCGTGATGAACGACAAGAATGAATCTAGTGTCATTCAC
CAACAGCTGAGCTCAATGGGTCGACGAAAAGGCAACCTCATTCTCAGTGTCTTTCAAAAGTCCCTGACCGGTCAC
TCCAAGGGCGCTGCGGGTGCCTGGATGCTCAATGGAGCCCTCCAAATGCTCGACTCGGGATTGGTCCCGGGTAAC
CGCAACGCTGATAATATCGATCCAAAGCTCGAGGAGTTTGCTGATCTGATCGCCTATGTGCAGCGGCCGATCCGT
GTTCCTGACATCAAGGCCGTTTCCGTCACCTCCTTTGGTTTTGGTCAGAAGGGAGCACAAGCTCTCTGTGTCCAT
CCCCGGTATCTCTTTGCCACTCTCGGCCGGGAAGAGTACGACACTTACCTCGACCGCTGCACTAAGCGAAAAACC
AAGGCGGATATGTTCTTTTACGAGGGAATGAATGGGAACTCCCTCTTCCGTGCCAAATCTGCGCCGCCATTTGCC
CCGTCTGAGGAGACGAAGACGTACCTTGACCCAACTGTCCGATTTACGTGTTAA
Transcript >Ani_SJS100_1|g6480.t1
ATGGCTGCCGATATGGATACCCAGCGCAAGCTGGCTCGCATACTGCTCATTGAGCTCATGGCATACCAATTTGCC
TCCCCAGTACAATGGATTGAAACGCAGGACGTAATCCTCTCTCGCAGGGAGTGCGACAAGATCGTCGAAATCGGG
CCCACTCCGACACTCGCGGGCATGTTTCAGCGAACCCTCAACAGCAAGTACCAGACTCAGGAGTGTACTAGATCT
ACACCTCGACGACTCTTGAATTCGGAGAAGGACACCCAAGAAGTCTATTTCGAAGACCGCCCTGGTGCCCCTGAT
GCTAAACTGAAGGAAAGGACAAAGAACGCAGCAAATACAGCTACCATACCATCACCTGTCAAAACAGAAGTGGCT
CCTGTAGCGCAACCAGAGACTGTATCGGCTCCGAAACCGAAGCCGACAACAATAGAAATTGAGGACGAAGGGGTA
AAGGCACAGCTGATTGTGACCGCGATAGTGTCACGAGCGCTTAAGAAGTCGCCGTCCGATGTTGACTGGACTAAG
ACTATCAAAGTTCTTGCTGGTGGGCGCTCAACGTTGGAAAATGAGGTTGTTGGAGATCTCCATGCAGAATTCGGC
ACGCTCCCAGAACGCGTCGAAGAGACACCTCTGGCTGAATTGTGGCAGGCGATCCAGCCAAGCCATAGCGGAATG
CTTGGGAAGGTTTCCACAGGCATGATTAATTCGCTTTTCACTTCCAAATTACCCAGTGGCTTCACCACCGCCGCC
GCGCGAGATCGACTCAAATCCCAGTGGGGTCTCAAACAAGGAAGACAGGATTCCTGTTTACTCCTTGCGACAACA
GAGGCACCTCCAACACGAATTTCATCCGAATCCGACGCAAAGACCTTTATTGATGGCGTCGTGGAGAGCTATGCT
TCGAAAAATAGTATACCTTTACACACATCTCATCCGTCTGCGGACGGAGCCTCGGCTTCTAATATCATGGTCGAT
CCTGAAGCGCTTAGAGCGATGTCTGAGGCCCAGAAAGCGGTGTCAAGACAGCTCCTTAATATTTATGCATCTCAG
CTCGGCCTGGACCTAGGCGCGGATCGACGTTCATTAGACGCTCTCCAACACGACATCAAGACCGGAATGCAATCA
GAGTTGGGTCTCTGGACGGAGGAGCATGGGGAAGACTACGCCAACGGTATTAAGCCACGTTTTGATTCCCGCAAG
GTCCGCATGTATGATTCGGCATGGAATTGGGGCCGTCAGAGGCTTCTCGAGCTGTTCGATCTAGTGACTCCAGTG
CAGCGTGGGGACGAAGTCACACTCGACCAAGGGAATGTCCTTGAAGCCTGCTACGCAATTGCCAACGCGGCAGAT
GAGACGCTCCTCCATGTAATCAATGAGATACTGGCCAAGCTAGGAAATTCTGCAGTTCCGCGCCCCATCTTTACT
GATCTAAAGGCTCTGTGCAAGCATGTGCTGGAGTTCGGGCCACTTTTCAAAGGATCCCCCAAGCAGATGGCGCCA
TTCACAACTATCGACAAGGACGGGACGATACGATATTTTGAGAAGGAACGTGAAGATAGAATTACTTTTGCCCAG
TTGGCATCGCCGACATCCGAAGCCGATGCTCATCCCTTTATCCACCTCAGAGAAAAAAGGGGAGATGCATGGTAC
TACAGTCGCATATTGACCGCAAAATTTCAAAATGCGCTCAGCTTGGTGCACGACCGGGGTTCGTCCTTCAATGGG
CAGACTGTGCTGATGACGGGAGCGGGGATTGGTTCAATCGGAGCTGCGATGATTCGACACTTCCTACAGGGGGGA
GCCAGAGTCGTTGTCACAACATCCTCTCTGTCCCCTGAGGTGGCCAAGGTATATCAGAGTATCTACATGGACCAC
GGTGCCAAGGGCTCTCAACTCATTGTTGTCCCATTCAACCAAGCCAGTGTTAAGGACGTCAATTCGTTGATTGAG
TACGTCTATTCACAAGGTGGTCTTGGCTGTGACATAGATTACTTTATCCCTTTTGCTGCACTTAGTGAGGCTGGA
CGACGACTCGACTCCATTGACTCTAAATCAGAGCTCGCCCACCGTTTGATGCTCACAAACGTGCTACGTTTGCTG
GGCACCATCAAGACCTGCAAGGAAAAGCACCGTTGTCATACCAACCCCACCCATGTCATCTTGCCTCTGTCTCCC
AACCATGGAACCATTGGTGGGGATGGCCTATACGGTGAGTCAAAATTGGGCCTAGAGACGCTGTTCAACCGGTGG
CATTCGGAGGATTGGCAGGACTACCTGTCCATCTGCGGTGCCGTCATCGGTTGGACAAGAGGAACCGGTCTAATG
AACCAGAATGATCTCATCGCAGAGGGCATCGAGGCGGCTGGCATGCGGACCTTTTCTCAGGAGGAGATGGCCTAT
GCTCTGGTCTGCCTATGTGTGCAGGAAATGACTGAGCTATGTCAGGAGAGGCCTCTTTACGCAGACCTAACGGGC
CGAATGGCAGAGGTGCAGGGACTCGGAGAAAAGCTGCAAGCGTTGCGTCAGGAGCTCAAGGAAAGAAGCGAAATA
CAAGCTGCGCTTCTCGCAGAGTCGATACTAGAGCAGCAATGCTCGACTGCCGGCCATTCTTCCCGACCGAGCACC
GGCTCGGACCGACTCGAGCAGAGAGCGCATGTGCGTTTAGACTTCCCCAAGCCGCTTGACTACGATCGGGATATC
CGCACTATTAGCTCAGACCTCCAGGGAATGGTGGACTTGGATCGAACCGTAGTGGTGACGGGGTTCTCGGAGTTA
GGGCCCGTGGGCAATGCTCGCACACGATGGGAGATGGAGGCATATGGCCAATTCTCCCTCGAGGGCGCCATTGAA
CTAGCCTGGCTCATGGGATACATCAGCCACTTCGCCGGAACCATCGATGGAGCTCCCTACTCCGGGTGGGTAGAC
ACTACGACAAAAAAGCCCGTTGCCGATATCGATGTGAAGTCAATCTACGAGGAAAGGATCTTGAATCATACCGGA
ATACGTCTAATCGAGTCAGAACGAAAGCCTTTCCTGCACGAGATTACATTGCAACAAGATTTGGAACCCCTCGAT
ATGCCTGAGTCGCTCGCCGAGCAGATGAAATTGGAACATGGAGAGTTCGCTGCAGTTCAACAATCGACAACACCG
GATCTATTCACAGTACAGCTTCGCAAAGGCGCTAGACTCTATATCCCTCGCGCAATGCAATCAACTCGGACCGTC
GCCGGACTCATACCGGATGGCTGGGATCCACGTGTTTATGGAATCCCCGAGGAAATTGTGTCTCAGGTCGACCGG
GTTACGCTCTTCACACTGGTGTGTACGGTTGAAGCGCTGCTGTCCTCTGGGATTACAGATCCGTATGAACTCTAT
CAGTATATCCACGTGTCCGAAGTAGGCACATGTATCGGTTCAGGGCTTGGAGGTGCCACTTCTCTGAACAAAATG
TTCAATGGGCGCCAAAGCACTCACGACATCCCGAAGGATATCCTACAAGAGACCTTCATCAATACCACAGGAGCT
TGGGTCAATATGCTTCTACTCTCGGCAAGTGGACCTCTTCGCACCCCAGTCGGGGCGTGTGCCACTGCTATCGAG
TCCCTAGAATTAGGGTATGATACTATCGTTACCGGTAAAGCTCAGTTCTGCTTGGTCGGCGGCTGTGATGATTTC
ACGACAGAGACCTCTCAGGAGTTTGCCAACATGAAGGCGACTAGCAACGTTGAGGAAGAAATCGCCAAAGGTCGA
GCTCCTCACGAAATGTCCCGACCGACCACCAGCACCCGCAGCGGCTTTGTGGAATCTCAGGGTTCCGGACTCCAG
GTGCTCACAACGGCGGCACTGGCGCTGAGAATGGGATTGCCGATTCGAGGCATCATTGCTTTTACCAGCACATCT
AGCGATAAGGCTGGCCGCTCGGTGCCAGCTCCTGGGAAGGGGGTACTTACCAACGCCAGGCACATTCCCTCAAGG
GTACCATCGCCTCTCATGAACATCCGCAATCGCCGGAAGCGGTTGGACTTCCGCCTCCGCCAGATTGCAGAAGCG
CGGGACGTGGCCTTGCAAGATCTCGACTTCGAAGTGGCTGCGGTGGTAGCCCAGAGCTCGACTGTGGATGTTGAG
GCCTACGTCAATGAGCGTCGGCAGCAGATAGCGGCTGACTTTGCTCGCGAGCAAAAGGATGCCCGCTTCAATCTC
GGCAACGACTTCTGGCGCAACGAGCCTAATATCGCACCACTTGCCGGCGCTCTAGCTACGTGGGGGCTCACCATC
GATGATCTGGATGTGGCATCCTTCCATGGCACGTCGACCGTGATGAACGACAAGAATGAATCTAGTGTCATTCAC
CAACAGCTGAGCTCAATGGGTCGACGAAAAGGCAACCTCATTCTCAGTGTCTTTCAAAAGTCCCTGACCGGTCAC
TCCAAGGGCGCTGCGGGTGCCTGGATGCTCAATGGAGCCCTCCAAATGCTCGACTCGGGATTGGTCCCGGGTAAC
CGCAACGCTGATAATATCGATCCAAAGCTCGAGGAGTTTGCTGATCTGATCGCCTATGTGCAGCGGCCGATCCGT
GTTCCTGACATCAAGGCCGTTTCCGTCACCTCCTTTGGTTTTGGTCAGAAGGGAGCACAAGCTCTCTGTGTCCAT
CCCCGGTATCTCTTTGCCACTCTCGGCCGGGAAGAGTACGACACTTACCTCGACCGCTGCACTAAGCGAAAAACC
AAGGCGGATATGTTCTTTTACGAGGGAATGAATGGGAACTCCCTCTTCCGTGCCAAATCTGCGCCGCCATTTGCC
CCGTCTGAGGAGACGAAGACGTACCTTGACCCAACTGTCCGATTTACGTGTTAA
Gene >Ani_SJS100_1|g6480.t1
ATGGCTGCCGATATGGATACCCAGCGCAAGCTGGCTCGCATACTGCTCATTGAGCTCATGGCGTGAGTAGAATAT
GATGAAGGGCGAAGCATGGGACAATAGCACTGACTGACAGCTGGGCTTTGTTTGACCTAGATACCAATTTGCCTC
CCCAGTACAATGGATTGAAACGCAGGACGTAATCCTCTCTCGCAGGGAGTGCGACAAGATCGTCGAAATCGGGCC
CACTCCGACACTCGCGGGCATGTTTCAGCGAACCCTCAACAGCAAGTACCAGACTCAGGAGTGTACTAGATCTAC
ACCTCGACGACTCTTGAATTCGGAGAAGGACACCCAAGAAGTCTATTTCGAAGACCGCCCTGGTGCCCCTGATGC
TAAACTGAAGGAAAGGACAAAGAACGCAGCAAATACAGCTACCATACCATCACCTGTCAAAACAGAAGTGGCTCC
TGTAGCGCAACCAGAGACTGTATCGGCTCCGAAACCGAAGCCGACAACAATAGAAATTGAGGACGAAGGGGTAAA
GGCACAGCTGATTGTGACCGCGATAGTGTCACGAGCGCTTAAGAAGTCGCCGTCCGATGTTGACTGGACTAAGAC
TATCAAAGTTCTTGCTGGTGGTAAGTTAAGAGTGGAGTGACTTGTTAATTATTTCCCCTGAATGCTGACAAACTA
TCAAGGGCGCTCAACGTTGGAAAATGAGGTTGTTGGAGATCTCCATGCAGAATTCGGCACGCTCCCAGAACGCGT
CGAAGAGACACCTCTGGCTGAATTGTGGCAGGCGATCCAGCCAAGCCATAGCGGAATGCTTGGGAAGGTTTCCAC
AGGCATGATTAATTCGCTTTTCACTTCCAAATTACCCAGTGGCTTCACCACCGCCGCCGCGCGAGATCGACTCAA
ATCCCAGTGGGGTCTCAAACAAGGAAGACAGGATTCCTGTTTACTCCTTGCGACAACAGAGGCACCTCCAACACG
AATTTCATCCGAATCCGACGCAAAGACCTTTATTGATGGCGTCGTGGAGAGCTATGCTTCGAAAAATAGTATACC
TTTACACACATCTCATCCGTCTGCGGACGGAGCCTCGGCTTCTAATATCATGGTCGATCCTGAAGCGCTTAGAGC
GATGTCTGAGGCCCAGAAAGCGGTGTCAAGACAGCTCCTTAATATTTATGCATCTCAGCTCGGCCTGGACCTAGG
CGCGGATCGACGTTCATTAGACGCTCTCCAACACGACATCAAGACCGGAATGCAATCAGAGTTGGGTCTCTGGAC
GGAGGAGCATGGGGAAGACTACGCCAACGGTATTAAGCCACGTTTTGATTCCCGCAAGGTCCGCATGTATGATTC
GGCATGGAATTGGGGCCGTCAGAGGCTTCTCGAGCTGTTCGATCTAGTGACTCCAGTGCAGCGTGGGGACGAAGT
CACACTCGACCAAGGGAATGTCCTTGAAGCCTGCTACGCAATTGCCAACGCGGCAGATGAGACGCTCCTCCATGT
AATCAATGAGATACTGGCCAAGCTAGGAAATTCTGCAGTTCCGCGCCCCATCTTTACTGATCTAAAGGCTCTGTG
CAAGCATGTGCTGGAGTTCGGGCCACTTTTCAAAGGATCCCCCAAGCAGATGGCGCCATTCACAACTATCGACAA
GGACGGGACGATACGATATTTTGAGAAGGAACGTGAAGATAGAATTACTTTTGCCCAGTTGGCATCGCCGACATC
CGAAGCCGATGCTCATCCCTTTATCCACCTCAGAGAAAAAAGGGGAGATGCATGGTACTACAGTCGCATATTGAC
CGCAAAATTTCAAAATGCGCTCAGCTTGGTGCACGACCGGGGTTCGTCCTTCAATGGGCAGACTGTGCTGATGAC
GGGAGCGGGGATTGGTTCAATCGGAGCTGCGATGATTCGACACTTCCTACAGGGGGGAGCCAGAGTCGTTGTCAC
AACATCCTCTCTGTCCCCTGAGGTGGCCAAGGTATATCAGAGTATCTACATGGACCACGGTGCCAAGGGCTCTCA
ACTCATTGTTGTCCCATTCAACCAAGCCAGTGTTAAGGACGTCAATTCGTTGATTGAGTACGTCTATTCACAAGG
TGGTCTTGGCTGTGACATAGATTACTTTATCCCTTTTGCTGCACTTAGTGAGGCTGGACGACGACTCGACTCCAT
TGACTCTAAATCAGAGCTCGCCCACCGTTTGATGCTCACAAACGTGCTACGTTTGCTGGGCACCATCAAGACCTG
CAAGGAAAAGCACCGTTGTCATACCAACCCCACCCATGTCATCTTGCCTCTGTCTCCCAACCATGGAACCATTGG
TGGGGATGGCCTATACGGTGAGTCAAAATTGGGCCTAGAGACGCTGTTCAACCGGTGGCATTCGGAGGATTGGCA
GGACTACCTGTCCATCTGCGGTGCCGTCATCGGTTGGACAAGAGGAACCGGTCTAATGAACCAGAATGATCTCAT
CGCAGAGGGCATCGAGGCGGCTGGCATGCGGACCTTTTCTCAGGAGGAGATGGCCTATGCTCTGGTCTGCCTATG
TGTGCAGGAAATGACTGAGCTATGTCAGGAGAGGCCTCTTTACGCAGACCTAACGGGCCGAATGGCAGAGGTGCA
GGGACTCGGAGAAAAGCTGCAAGCGTTGCGTCAGGAGCTCAAGGAAAGAAGCGAAATACAAGCTGCGCTTCTCGC
AGAGTCGATACTAGAGCAGCAATGCTCGACTGCCGGCCATTCTTCCCGACCGAGCACCGGCTCGGACCGACTCGA
GCAGAGAGCGCATGTGCGTTTAGACTTCCCCAAGCCGCTTGACTACGATCGGGATATCCGCACTATTAGCTCAGA
CCTCCAGGGAATGGTGGACTTGGATCGAACCGTAGTGGTGACGGGGTTCTCGGAGTTAGGGCCCGTGGGCAATGC
TCGCACACGATGGGAGATGGAGGCATATGGCCAATTCTCCCTCGAGGGCGCCATTGAACTAGCCTGGCTCATGGG
ATACATCAGCCACTTCGCCGGAACCATCGATGGAGCTCCCTACTCCGGGTGGGTAGACACTACGACAAAAAAGCC
CGTTGCCGATATCGATGTGAAGTCAATCTACGAGGAAAGGATCTTGAATCATACCGGAATACGTCTAATCGAGTC
AGAACGAAAGCCTTTCCTGCACGAGATTACATTGCAACAAGATTTGGAACCCCTCGATATGCCTGAGTCGCTCGC
CGAGCAGATGAAATTGGAACATGGAGAGTTCGCTGCAGTTCAACAATCGACAACACCGGATCTATTCACAGTACA
GCTTCGCAAAGGCGCTAGACTCTATATCCCTCGCGCAATGCAATCAACTCGGACCGTCGCCGGACTCATACCGGA
TGGCTGGGATCCACGTGTTTATGGAATCCCCGAGGAAATTGTGTCTCAGGTCGACCGGGTTACGCTCTTCACACT
GGTGTGTACGGTTGAAGCGCTGCTGTCCTCTGGGATTACAGATCCGTATGAACTCTATCAGTATATCCACGTGTC
CGAAGTAGGCACATGTATCGGTTCAGGGCTTGGAGGTGCCACTTCTCTGAACAAAATGTTCAATGGGCGCCAAAG
CACTCACGACATCCCGAAGGATATCCTACAAGAGACCTTCATCAATACCACAGGAGCTTGGGTCAATATGCTTCT
ACTCTCGGCAAGTGGACCTCTTCGCACCCCAGTCGGGGCGTGTGCCACTGCTATCGAGTCCCTAGAATTAGGGTA
TGATACTATCGTTACCGGTAAAGCTCAGTTCTGCTTGGTCGGCGGCTGTGATGATTTCACGACAGAGACCTCTCA
GGAGTTTGCCAACATGAAGGCGACTAGCAACGTTGAGGAAGAAATCGCCAAAGGTCGAGCTCCTCACGAAATGTC
CCGACCGACCACCAGCACCCGCAGCGGCTTTGTGGAATCTCAGGGTTCCGGACTCCAGGTGCTCACAACGGCGGC
ACTGGCGCTGAGAATGGGATTGCCGATTCGAGGCATCATTGCTTTTACCAGCACATCTAGCGATAAGGCTGGCCG
CTCGGTGCCAGCTCCTGGGAAGGGGGTACTTACCAACGCCAGGCACATTCCCTCAAGGGTACCATCGCCTCTCAT
GAACATCCGCAATCGCCGGAAGCGGTTGGACTTCCGCCTCCGCCAGATTGCAGAAGCGCGGGACGTGGCCTTGCA
AGATCTCGACTTCGAAGTGGCTGCGGTGGTAGCCCAGAGCTCGACTGTGGATGTTGAGGCCTACGTCAATGAGCG
TCGGCAGCAGATAGCGGCTGACTTTGCTCGCGAGCAAAAGGATGCCCGCTTCAATCTCGGCAACGACTTCTGGCG
CAACGAGCCTAATATCGCACCACTTGCCGGCGCTCTAGCTACGTGGGGGCTCACCATCGATGATCTGGATGTGGC
ATCCTTCCATGGCACGTCGACCGTGATGAACGACAAGAATGAATCTAGTGTCATTCACCAACAGCTGAGCTCAAT
GGGTCGACGAAAAGGCAACCTCATTCTCAGTGTCTTTCAAAAGTCCCTGACCGGTCACTCCAAGGGCGCTGCGGG
TGCCTGGATGCTCAATGGAGCCCTCCAAATGCTCGACTCGGGATTGGTCCCGGGTAACCGCAACGCTGATAATAT
CGATCCAAAGCTCGAGGAGTTTGCTGATCTGATCGCCTATGTGCAGCGGCCGATCCGTGTTCCTGACATCAAGGC
CGTTTCCGTCACCTCCTTTGGTTTTGGTCAGAAGGGAGCACAAGCTCTCTGTGTCCATCCCCGGTATCTCTTTGC
CACTCTCGGCCGGGAAGAGTACGACACTTACCTCGACCGCTGCACTAAGCGAAAAACCAAGGCGGATATGTTCTT
TTACGAGGGAATGAATGGGAACTCCCTCTTCCGTGCCAAATCTGCGCCGCCATTTGCCCCGTCTGAGGAGACGAA
GACGTACCTTGACCCAACTGTCCGATTTACGTGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail