Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6433.t1
Gene name
Locationscaffold_040:53727..59067
Strand+
Gene length (bp)5340
Transcript length (bp)5340
Coding sequence length (bp)5340
Protein length (aa) 1780

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 3.3E-86 45 293
PF00698 Acyl_transf_1 Acyl transferase domain 1.8E-61 585 898
PF08659 KR KR domain 1.8E-59 1416 1605
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 5.5E-40 301 420
PF14765 PS-DH Polyketide synthase dehydratase 1.6E-14 950 1216
PF00550 PP-binding Phosphopantetheine attachment site 5.2E-10 1711 1772
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 2.5E-08 426 548

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6433.t1
MPASRSSTKFSTPAEGSDNGKEFTTPATSTEGHEVPDRPGDALADVAIIGMACRTPGDVRSPDSLWQYLLKKGDA
SGSLPDWRWEPYRQRHPRNAALLAQTTAKGYFLDNIDHFDAAFFSISPREAEQMDPQQRLALEVAWEALENAGIS
PPQLAGSNTSVYMGVNSDDYAKLLLEDLPNVDAHMGVGTAYCGIPSRISYILDLMGPSVALDAACASSLVAVHHA
RQAIRAGETDLAIAGGVNALLGPGLTRVLDEAGAISADGKCRSFDETASGYGRGEGAGVVILKRLDKALADGDHV
LAVLKGSAVASDGKTLGIMAPNARAQLLVAQKALAEAKVSADSINYVEAHATSTSLGDPTETNALAEVYGAGSGR
SPSDPCYIGSIKPNIGHLEAGAGVMGLIKAVLVLRHGQVPPQANLKTLNSKIAWNENLLCPPRELVTLPCPGPIH
PLRAAVASYGYSGTVSHAVLEAFAGHSEFAERLSQIPTGDDPSPVLLLISAPQARRVSAAAGALKQWLSENEASI
SLKTVSSTLAQRRAHHRYRHAIVADSVPDAIAALDDVSKEAPNRWVIKDKIDAKAVKGPVWIFSGHGAQWADMGR
ELFESSPAFEEVVRNLEPIIQDEVGFSAIEILQKGCPDRSDVVQVMTFLMHLGIAAVLEIESGPPSAVVGHSLGE
AAAAVVSGALTWREGALVVCRRARLYRELMGQGAMALVRVSTEEARTRIGRQTGVWVAIETSPSACVLSGEVDAV
KQLSDRWREEGIEVRMVASDVPFHTPMLERLAKPLYESLRGELHPRVPNRALFSTSQPDPRSEVLRDAQYWVTNM
IQPVRLQSAIAAIAQDGFRALVEVSSHPIVTHSVVETMGECTEDPVLVTPTMVRRQPALKSILAATGRLHCFGCA
IKFIELDPNAPWNSSVPSTVWHHQPFYRAVSQTSASSQLETTHDPAANNLLGKRIALWGTEEVLYQTRLEEENRP
FPGHHPLHGSEIVPAAVLLRTFLQALTPRCVEQVSLQVPVVVSPARKVQIRHNTRNITITSCLEESSSQEDGSWL
VNTTAAVGAANVVPSQSRMDLSELRKRLPQKLADSFSIDYLASVGVSAMGFPWQVTHHVASDDEMLARVDANPDN
MGGMNDFLTSLMDAATSISSTLWHRQPLLRMPTSVRRVVAVHEIPIPRVVYIHCTKVASTSECTADVTLTGEDGT
VLMEIQGMSFAGLEGESFSRKSTAGLVHQIQWPPAALVEDPSEFSHIAFVTPDITDPRLEQYQSQLDALAITSSV
HQAASDLPLTSHTSLAVVYLPQTMTDVFDTATRSCNDLVSIIQTITAAASSTTRVFVLTAGTELGHSALLGLSRI
IQAEHPDIWGSLIEVEDTFSLPLMAMRYVRDADVIRIKDGVPRIARLRPLPSASSSLTPLTFSPASTYLITGGLG
ALGLSVAHWMVTQGARRLLLLSRRALPPRSTWSSTHMNNPTIQSILALERLGATVHCLPIDISLPMAASGLRSTL
ETLNLPSVAGVIHAAGIVSDQLVEQVTPDVLESVLAPKIKGALNLHDVFPPASLDFFVLFSSCGQLLGFPGQASY
ASGNAFLDGLARSRRAQGDNAISLLWTTWRGMGMGQSANGAMEAELYARGITDITPDEAFRAWSAVASTGGGGTD
HAVIVRARVLEGGEPLPHPILTDIATRKAEVVNAGEHPAGSQEVKLSGRELEQHLRDVINGCVSKTLSVKEDEID
DAVALAEMGMDSVMTVNFRMTLQQTLKVPVGPTLIWKCPTVQHLVKHFTKELDA*
Coding >Ani_SJS100_1|g6433.t1
ATGCCCGCCTCCAGAAGCAGCACAAAGTTCTCCACCCCTGCTGAGGGCTCCGACAACGGCAAGGAATTCACCACG
CCGGCGACCAGTACCGAGGGCCACGAAGTCCCGGACAGGCCTGGAGATGCCCTTGCTGATGTCGCCATTATTGGA
ATGGCCTGTCGCACGCCCGGAGACGTCCGCTCACCCGACAGTCTGTGGCAATACCTCTTGAAGAAGGGGGATGCA
TCTGGTAGCCTTCCCGACTGGCGTTGGGAGCCCTATCGACAGCGCCATCCTCGCAATGCGGCCCTGCTCGCCCAG
ACCACAGCCAAGGGTTACTTCCTCGACAACATTGATCATTTTGATGCTGCCTTCTTCTCCATTTCACCTAGAGAG
GCGGAGCAAATGGATCCTCAGCAACGCCTTGCGCTGGAGGTTGCCTGGGAGGCCCTGGAAAATGCCGGAATATCA
CCTCCCCAGCTTGCGGGTTCCAACACCTCAGTCTACATGGGGGTAAACTCAGACGACTACGCCAAGTTACTCCTC
GAAGATCTGCCGAATGTTGACGCTCACATGGGGGTGGGCACTGCCTATTGTGGGATTCCGAGCCGGATCTCGTAT
ATTTTGGATCTCATGGGACCCAGCGTTGCCTTAGACGCAGCTTGTGCTTCCTCCTTGGTGGCTGTCCACCACGCA
CGCCAAGCAATCCGGGCTGGAGAAACTGATCTGGCAATAGCAGGTGGGGTCAATGCTCTGCTTGGTCCCGGCTTG
ACCCGAGTACTGGACGAAGCTGGAGCTATATCCGCCGATGGCAAGTGTCGCTCCTTCGATGAGACAGCCAGCGGC
TATGGTAGAGGAGAAGGAGCAGGCGTCGTGATCCTCAAGCGATTGGACAAGGCACTTGCAGATGGCGACCATGTG
CTGGCTGTGCTCAAGGGCAGTGCAGTCGCTTCGGATGGCAAGACCTTGGGGATCATGGCCCCCAATGCGCGTGCC
CAACTACTAGTGGCCCAGAAGGCCCTCGCAGAGGCCAAAGTGTCTGCTGACTCGATCAACTACGTCGAAGCTCAT
GCAACGTCCACATCCCTGGGCGATCCAACCGAAACCAACGCTCTGGCAGAAGTCTATGGTGCGGGATCGGGGCGC
AGCCCATCTGATCCCTGTTATATCGGCTCCATCAAACCCAACATTGGTCATTTGGAGGCCGGTGCCGGAGTGATG
GGACTCATCAAAGCGGTACTGGTTCTTCGCCACGGCCAGGTTCCCCCGCAGGCCAATCTCAAGACGCTGAATAGC
AAAATTGCCTGGAACGAGAATCTGCTGTGTCCACCGCGCGAGCTGGTGACCTTGCCGTGCCCGGGGCCGATTCAT
CCTTTACGCGCGGCCGTGGCATCATACGGATATAGTGGTACTGTGTCGCACGCGGTACTCGAAGCATTTGCAGGA
CACTCCGAATTTGCCGAACGTCTGTCGCAGATCCCTACCGGCGATGATCCTTCGCCCGTTCTTCTCCTCATTTCC
GCACCCCAGGCTCGTCGGGTTTCCGCCGCCGCGGGCGCTCTAAAGCAGTGGCTTAGCGAGAATGAAGCATCTATA
TCTCTGAAGACCGTCTCGTCGACTCTGGCTCAACGCCGGGCTCACCATCGCTATCGCCATGCCATTGTGGCGGAC
TCCGTCCCCGATGCCATTGCCGCACTCGATGATGTTAGCAAGGAGGCACCGAATCGATGGGTTATCAAGGACAAG
ATCGATGCTAAGGCCGTTAAGGGCCCAGTGTGGATCTTTTCTGGTCATGGTGCGCAGTGGGCAGACATGGGCCGT
GAGTTATTCGAATCGAGTCCGGCATTCGAGGAGGTGGTCCGCAACCTAGAGCCCATCATCCAGGATGAGGTAGGA
TTCTCCGCCATTGAAATTCTGCAAAAGGGATGCCCCGATCGCTCCGACGTGGTACAGGTCATGACGTTCCTGATG
CATCTTGGCATTGCAGCCGTCCTAGAGATTGAGTCAGGGCCTCCCAGTGCTGTCGTGGGCCACTCCCTAGGCGAG
GCCGCCGCAGCCGTGGTGTCCGGCGCTTTGACCTGGCGCGAAGGGGCTCTCGTCGTGTGCCGTCGGGCGCGGCTA
TATCGCGAGCTCATGGGGCAAGGCGCTATGGCTCTAGTGCGAGTATCTACTGAGGAGGCTCGTACCCGTATTGGC
AGGCAAACTGGAGTTTGGGTAGCGATTGAAACATCCCCTAGCGCGTGTGTTTTGTCTGGTGAGGTGGACGCCGTT
AAGCAACTCTCAGATCGGTGGCGCGAGGAGGGAATTGAGGTGCGTATGGTCGCCTCGGACGTGCCCTTCCATACG
CCAATGCTGGAGAGATTGGCCAAGCCTCTTTATGAGTCGCTACGGGGAGAGCTTCATCCCCGTGTCCCCAACCGG
GCGCTCTTTTCGACCTCGCAGCCGGATCCCCGTTCCGAGGTTTTGCGCGATGCCCAGTACTGGGTGACCAACATG
ATTCAGCCCGTTCGGCTGCAGTCTGCTATCGCTGCCATTGCACAAGATGGCTTCCGTGCCCTGGTGGAAGTGTCT
AGCCACCCCATCGTGACACACTCCGTCGTGGAAACTATGGGGGAATGTACCGAGGACCCCGTTCTCGTCACCCCT
ACCATGGTACGTCGCCAGCCTGCGCTAAAGAGCATTTTGGCCGCGACAGGTCGACTGCATTGCTTCGGTTGTGCC
ATCAAATTTATTGAGTTGGACCCTAATGCGCCTTGGAACTCGAGCGTACCCAGTACTGTCTGGCACCATCAACCA
TTCTATCGAGCCGTGAGCCAAACATCGGCATCATCCCAACTCGAAACCACCCACGACCCGGCTGCTAACAACCTT
TTGGGGAAGCGCATCGCCCTTTGGGGTACAGAAGAGGTGCTGTATCAGACCCGCTTAGAGGAGGAGAACCGGCCA
TTTCCCGGTCATCACCCGCTCCATGGTTCCGAGATCGTGCCGGCGGCGGTGTTGCTACGCACATTCCTGCAGGCT
CTGACGCCCCGGTGTGTAGAGCAGGTGTCGCTTCAAGTCCCGGTTGTGGTGTCGCCGGCTCGCAAGGTCCAGATC
CGCCACAACACCCGCAACATTACAATCACTTCGTGCCTGGAGGAGTCGAGCAGCCAAGAGGATGGGTCCTGGTTG
GTAAACACCACGGCTGCAGTGGGTGCCGCGAATGTTGTGCCTAGTCAGAGTCGTATGGACCTGTCAGAGTTGCGC
AAGCGATTGCCTCAAAAGCTGGCTGACAGCTTTTCCATTGACTACCTAGCATCCGTAGGTGTATCTGCCATGGGC
TTTCCGTGGCAAGTGACCCACCATGTCGCCAGCGACGACGAGATGCTGGCACGGGTAGACGCAAACCCGGATAAT
ATGGGAGGGATGAATGACTTCTTGACCTCGCTCATGGATGCTGCGACCTCGATCTCCTCTACTCTTTGGCACCGC
CAGCCTCTGCTTCGCATGCCCACGTCAGTGCGTCGTGTCGTTGCCGTCCACGAGATCCCTATCCCGCGAGTAGTC
TACATCCACTGCACGAAAGTCGCATCCACCAGCGAGTGCACCGCTGATGTGACCCTTACTGGCGAGGATGGCACA
GTCTTGATGGAGATCCAGGGCATGTCATTTGCCGGTTTAGAGGGCGAGAGTTTCTCGCGAAAGAGCACTGCAGGT
CTAGTCCACCAGATTCAATGGCCTCCGGCAGCACTTGTCGAGGACCCTTCGGAATTCAGTCACATCGCCTTTGTC
ACGCCAGACATCACCGATCCTCGGCTGGAACAATATCAGAGCCAGCTCGATGCGCTGGCCATCACCTCCTCCGTC
CACCAGGCCGCTTCGGACCTACCCTTGACCAGTCATACCTCTCTCGCGGTGGTCTATCTGCCACAGACCATGACA
GATGTCTTTGATACGGCAACCAGATCCTGTAATGACCTTGTTTCCATCATACAGACTATCACTGCGGCTGCTTCT
TCAACTACGCGTGTCTTCGTCCTCACCGCAGGAACCGAACTCGGTCACAGCGCTCTTTTGGGTCTCAGCCGAATC
ATCCAGGCTGAACACCCTGACATCTGGGGTAGTCTCATTGAGGTCGAAGACACTTTCTCTCTCCCACTTATGGCC
ATGCGCTATGTTCGGGATGCCGATGTGATCAGGATCAAAGATGGCGTCCCACGCATTGCTCGTCTTCGGCCGCTT
CCATCTGCTTCTTCCTCCTTAACGCCTCTCACCTTCTCTCCGGCCTCGACCTATCTCATCACCGGCGGACTGGGT
GCTCTTGGACTGTCAGTTGCCCACTGGATGGTTACCCAAGGCGCTCGGCGGCTCCTCTTGCTATCTCGTCGCGCT
CTTCCTCCGCGCAGCACATGGTCTTCCACGCATATGAACAATCCTACCATCCAAAGCATTTTGGCCCTCGAACGC
CTCGGAGCCACGGTCCACTGCCTTCCCATCGACATCTCTCTGCCCATGGCTGCCTCCGGACTTCGGTCCACCCTG
GAGACTCTGAACCTTCCTTCCGTAGCTGGTGTTATCCATGCCGCTGGAATTGTCAGTGACCAGCTCGTTGAGCAA
GTGACTCCGGATGTCCTGGAGTCTGTACTAGCGCCTAAGATCAAAGGTGCTCTCAACTTACATGATGTCTTCCCT
CCAGCGTCCCTGGACTTCTTTGTTCTGTTCTCCTCATGCGGTCAGCTACTCGGATTTCCCGGGCAAGCATCGTAC
GCCAGCGGAAACGCCTTTCTCGATGGCCTCGCTCGGTCTCGCAGAGCCCAGGGCGATAATGCCATCTCGCTGCTC
TGGACCACGTGGCGTGGAATGGGCATGGGGCAGTCCGCCAACGGCGCGATGGAAGCGGAGCTCTATGCGCGCGGA
ATCACCGATATCACACCCGACGAAGCGTTCCGGGCCTGGAGTGCCGTGGCATCCACTGGTGGCGGAGGCACAGAT
CATGCAGTAATTGTGCGAGCGAGAGTGTTAGAAGGTGGAGAGCCCTTGCCCCATCCTATCCTTACGGACATCGCT
ACAAGGAAGGCAGAGGTTGTCAATGCTGGAGAGCATCCCGCGGGTAGCCAGGAAGTGAAGTTGAGTGGAAGGGAG
TTGGAGCAACATCTCCGGGATGTCATTAATGGATGTGTATCGAAGACATTGTCTGTCAAGGAGGACGAGATTGAT
GATGCTGTGGCATTGGCAGAGATGGGTATGGATTCAGTGATGACGGTCAATTTCCGAATGACCCTGCAACAGACG
CTCAAAGTGCCAGTCGGGCCAACGTTAATCTGGAAATGCCCGACTGTGCAGCATTTGGTGAAGCACTTTACAAAG
GAGCTGGATGCTTAA
Transcript >Ani_SJS100_1|g6433.t1
ATGCCCGCCTCCAGAAGCAGCACAAAGTTCTCCACCCCTGCTGAGGGCTCCGACAACGGCAAGGAATTCACCACG
CCGGCGACCAGTACCGAGGGCCACGAAGTCCCGGACAGGCCTGGAGATGCCCTTGCTGATGTCGCCATTATTGGA
ATGGCCTGTCGCACGCCCGGAGACGTCCGCTCACCCGACAGTCTGTGGCAATACCTCTTGAAGAAGGGGGATGCA
TCTGGTAGCCTTCCCGACTGGCGTTGGGAGCCCTATCGACAGCGCCATCCTCGCAATGCGGCCCTGCTCGCCCAG
ACCACAGCCAAGGGTTACTTCCTCGACAACATTGATCATTTTGATGCTGCCTTCTTCTCCATTTCACCTAGAGAG
GCGGAGCAAATGGATCCTCAGCAACGCCTTGCGCTGGAGGTTGCCTGGGAGGCCCTGGAAAATGCCGGAATATCA
CCTCCCCAGCTTGCGGGTTCCAACACCTCAGTCTACATGGGGGTAAACTCAGACGACTACGCCAAGTTACTCCTC
GAAGATCTGCCGAATGTTGACGCTCACATGGGGGTGGGCACTGCCTATTGTGGGATTCCGAGCCGGATCTCGTAT
ATTTTGGATCTCATGGGACCCAGCGTTGCCTTAGACGCAGCTTGTGCTTCCTCCTTGGTGGCTGTCCACCACGCA
CGCCAAGCAATCCGGGCTGGAGAAACTGATCTGGCAATAGCAGGTGGGGTCAATGCTCTGCTTGGTCCCGGCTTG
ACCCGAGTACTGGACGAAGCTGGAGCTATATCCGCCGATGGCAAGTGTCGCTCCTTCGATGAGACAGCCAGCGGC
TATGGTAGAGGAGAAGGAGCAGGCGTCGTGATCCTCAAGCGATTGGACAAGGCACTTGCAGATGGCGACCATGTG
CTGGCTGTGCTCAAGGGCAGTGCAGTCGCTTCGGATGGCAAGACCTTGGGGATCATGGCCCCCAATGCGCGTGCC
CAACTACTAGTGGCCCAGAAGGCCCTCGCAGAGGCCAAAGTGTCTGCTGACTCGATCAACTACGTCGAAGCTCAT
GCAACGTCCACATCCCTGGGCGATCCAACCGAAACCAACGCTCTGGCAGAAGTCTATGGTGCGGGATCGGGGCGC
AGCCCATCTGATCCCTGTTATATCGGCTCCATCAAACCCAACATTGGTCATTTGGAGGCCGGTGCCGGAGTGATG
GGACTCATCAAAGCGGTACTGGTTCTTCGCCACGGCCAGGTTCCCCCGCAGGCCAATCTCAAGACGCTGAATAGC
AAAATTGCCTGGAACGAGAATCTGCTGTGTCCACCGCGCGAGCTGGTGACCTTGCCGTGCCCGGGGCCGATTCAT
CCTTTACGCGCGGCCGTGGCATCATACGGATATAGTGGTACTGTGTCGCACGCGGTACTCGAAGCATTTGCAGGA
CACTCCGAATTTGCCGAACGTCTGTCGCAGATCCCTACCGGCGATGATCCTTCGCCCGTTCTTCTCCTCATTTCC
GCACCCCAGGCTCGTCGGGTTTCCGCCGCCGCGGGCGCTCTAAAGCAGTGGCTTAGCGAGAATGAAGCATCTATA
TCTCTGAAGACCGTCTCGTCGACTCTGGCTCAACGCCGGGCTCACCATCGCTATCGCCATGCCATTGTGGCGGAC
TCCGTCCCCGATGCCATTGCCGCACTCGATGATGTTAGCAAGGAGGCACCGAATCGATGGGTTATCAAGGACAAG
ATCGATGCTAAGGCCGTTAAGGGCCCAGTGTGGATCTTTTCTGGTCATGGTGCGCAGTGGGCAGACATGGGCCGT
GAGTTATTCGAATCGAGTCCGGCATTCGAGGAGGTGGTCCGCAACCTAGAGCCCATCATCCAGGATGAGGTAGGA
TTCTCCGCCATTGAAATTCTGCAAAAGGGATGCCCCGATCGCTCCGACGTGGTACAGGTCATGACGTTCCTGATG
CATCTTGGCATTGCAGCCGTCCTAGAGATTGAGTCAGGGCCTCCCAGTGCTGTCGTGGGCCACTCCCTAGGCGAG
GCCGCCGCAGCCGTGGTGTCCGGCGCTTTGACCTGGCGCGAAGGGGCTCTCGTCGTGTGCCGTCGGGCGCGGCTA
TATCGCGAGCTCATGGGGCAAGGCGCTATGGCTCTAGTGCGAGTATCTACTGAGGAGGCTCGTACCCGTATTGGC
AGGCAAACTGGAGTTTGGGTAGCGATTGAAACATCCCCTAGCGCGTGTGTTTTGTCTGGTGAGGTGGACGCCGTT
AAGCAACTCTCAGATCGGTGGCGCGAGGAGGGAATTGAGGTGCGTATGGTCGCCTCGGACGTGCCCTTCCATACG
CCAATGCTGGAGAGATTGGCCAAGCCTCTTTATGAGTCGCTACGGGGAGAGCTTCATCCCCGTGTCCCCAACCGG
GCGCTCTTTTCGACCTCGCAGCCGGATCCCCGTTCCGAGGTTTTGCGCGATGCCCAGTACTGGGTGACCAACATG
ATTCAGCCCGTTCGGCTGCAGTCTGCTATCGCTGCCATTGCACAAGATGGCTTCCGTGCCCTGGTGGAAGTGTCT
AGCCACCCCATCGTGACACACTCCGTCGTGGAAACTATGGGGGAATGTACCGAGGACCCCGTTCTCGTCACCCCT
ACCATGGTACGTCGCCAGCCTGCGCTAAAGAGCATTTTGGCCGCGACAGGTCGACTGCATTGCTTCGGTTGTGCC
ATCAAATTTATTGAGTTGGACCCTAATGCGCCTTGGAACTCGAGCGTACCCAGTACTGTCTGGCACCATCAACCA
TTCTATCGAGCCGTGAGCCAAACATCGGCATCATCCCAACTCGAAACCACCCACGACCCGGCTGCTAACAACCTT
TTGGGGAAGCGCATCGCCCTTTGGGGTACAGAAGAGGTGCTGTATCAGACCCGCTTAGAGGAGGAGAACCGGCCA
TTTCCCGGTCATCACCCGCTCCATGGTTCCGAGATCGTGCCGGCGGCGGTGTTGCTACGCACATTCCTGCAGGCT
CTGACGCCCCGGTGTGTAGAGCAGGTGTCGCTTCAAGTCCCGGTTGTGGTGTCGCCGGCTCGCAAGGTCCAGATC
CGCCACAACACCCGCAACATTACAATCACTTCGTGCCTGGAGGAGTCGAGCAGCCAAGAGGATGGGTCCTGGTTG
GTAAACACCACGGCTGCAGTGGGTGCCGCGAATGTTGTGCCTAGTCAGAGTCGTATGGACCTGTCAGAGTTGCGC
AAGCGATTGCCTCAAAAGCTGGCTGACAGCTTTTCCATTGACTACCTAGCATCCGTAGGTGTATCTGCCATGGGC
TTTCCGTGGCAAGTGACCCACCATGTCGCCAGCGACGACGAGATGCTGGCACGGGTAGACGCAAACCCGGATAAT
ATGGGAGGGATGAATGACTTCTTGACCTCGCTCATGGATGCTGCGACCTCGATCTCCTCTACTCTTTGGCACCGC
CAGCCTCTGCTTCGCATGCCCACGTCAGTGCGTCGTGTCGTTGCCGTCCACGAGATCCCTATCCCGCGAGTAGTC
TACATCCACTGCACGAAAGTCGCATCCACCAGCGAGTGCACCGCTGATGTGACCCTTACTGGCGAGGATGGCACA
GTCTTGATGGAGATCCAGGGCATGTCATTTGCCGGTTTAGAGGGCGAGAGTTTCTCGCGAAAGAGCACTGCAGGT
CTAGTCCACCAGATTCAATGGCCTCCGGCAGCACTTGTCGAGGACCCTTCGGAATTCAGTCACATCGCCTTTGTC
ACGCCAGACATCACCGATCCTCGGCTGGAACAATATCAGAGCCAGCTCGATGCGCTGGCCATCACCTCCTCCGTC
CACCAGGCCGCTTCGGACCTACCCTTGACCAGTCATACCTCTCTCGCGGTGGTCTATCTGCCACAGACCATGACA
GATGTCTTTGATACGGCAACCAGATCCTGTAATGACCTTGTTTCCATCATACAGACTATCACTGCGGCTGCTTCT
TCAACTACGCGTGTCTTCGTCCTCACCGCAGGAACCGAACTCGGTCACAGCGCTCTTTTGGGTCTCAGCCGAATC
ATCCAGGCTGAACACCCTGACATCTGGGGTAGTCTCATTGAGGTCGAAGACACTTTCTCTCTCCCACTTATGGCC
ATGCGCTATGTTCGGGATGCCGATGTGATCAGGATCAAAGATGGCGTCCCACGCATTGCTCGTCTTCGGCCGCTT
CCATCTGCTTCTTCCTCCTTAACGCCTCTCACCTTCTCTCCGGCCTCGACCTATCTCATCACCGGCGGACTGGGT
GCTCTTGGACTGTCAGTTGCCCACTGGATGGTTACCCAAGGCGCTCGGCGGCTCCTCTTGCTATCTCGTCGCGCT
CTTCCTCCGCGCAGCACATGGTCTTCCACGCATATGAACAATCCTACCATCCAAAGCATTTTGGCCCTCGAACGC
CTCGGAGCCACGGTCCACTGCCTTCCCATCGACATCTCTCTGCCCATGGCTGCCTCCGGACTTCGGTCCACCCTG
GAGACTCTGAACCTTCCTTCCGTAGCTGGTGTTATCCATGCCGCTGGAATTGTCAGTGACCAGCTCGTTGAGCAA
GTGACTCCGGATGTCCTGGAGTCTGTACTAGCGCCTAAGATCAAAGGTGCTCTCAACTTACATGATGTCTTCCCT
CCAGCGTCCCTGGACTTCTTTGTTCTGTTCTCCTCATGCGGTCAGCTACTCGGATTTCCCGGGCAAGCATCGTAC
GCCAGCGGAAACGCCTTTCTCGATGGCCTCGCTCGGTCTCGCAGAGCCCAGGGCGATAATGCCATCTCGCTGCTC
TGGACCACGTGGCGTGGAATGGGCATGGGGCAGTCCGCCAACGGCGCGATGGAAGCGGAGCTCTATGCGCGCGGA
ATCACCGATATCACACCCGACGAAGCGTTCCGGGCCTGGAGTGCCGTGGCATCCACTGGTGGCGGAGGCACAGAT
CATGCAGTAATTGTGCGAGCGAGAGTGTTAGAAGGTGGAGAGCCCTTGCCCCATCCTATCCTTACGGACATCGCT
ACAAGGAAGGCAGAGGTTGTCAATGCTGGAGAGCATCCCGCGGGTAGCCAGGAAGTGAAGTTGAGTGGAAGGGAG
TTGGAGCAACATCTCCGGGATGTCATTAATGGATGTGTATCGAAGACATTGTCTGTCAAGGAGGACGAGATTGAT
GATGCTGTGGCATTGGCAGAGATGGGTATGGATTCAGTGATGACGGTCAATTTCCGAATGACCCTGCAACAGACG
CTCAAAGTGCCAGTCGGGCCAACGTTAATCTGGAAATGCCCGACTGTGCAGCATTTGGTGAAGCACTTTACAAAG
GAGCTGGATGCTTAA
Gene >Ani_SJS100_1|g6433.t1
ATGCCCGCCTCCAGAAGCAGCACAAAGTTCTCCACCCCTGCTGAGGGCTCCGACAACGGCAAGGAATTCACCACG
CCGGCGACCAGTACCGAGGGCCACGAAGTCCCGGACAGGCCTGGAGATGCCCTTGCTGATGTCGCCATTATTGGA
ATGGCCTGTCGCACGCCCGGAGACGTCCGCTCACCCGACAGTCTGTGGCAATACCTCTTGAAGAAGGGGGATGCA
TCTGGTAGCCTTCCCGACTGGCGTTGGGAGCCCTATCGACAGCGCCATCCTCGCAATGCGGCCCTGCTCGCCCAG
ACCACAGCCAAGGGTTACTTCCTCGACAACATTGATCATTTTGATGCTGCCTTCTTCTCCATTTCACCTAGAGAG
GCGGAGCAAATGGATCCTCAGCAACGCCTTGCGCTGGAGGTTGCCTGGGAGGCCCTGGAAAATGCCGGAATATCA
CCTCCCCAGCTTGCGGGTTCCAACACCTCAGTCTACATGGGGGTAAACTCAGACGACTACGCCAAGTTACTCCTC
GAAGATCTGCCGAATGTTGACGCTCACATGGGGGTGGGCACTGCCTATTGTGGGATTCCGAGCCGGATCTCGTAT
ATTTTGGATCTCATGGGACCCAGCGTTGCCTTAGACGCAGCTTGTGCTTCCTCCTTGGTGGCTGTCCACCACGCA
CGCCAAGCAATCCGGGCTGGAGAAACTGATCTGGCAATAGCAGGTGGGGTCAATGCTCTGCTTGGTCCCGGCTTG
ACCCGAGTACTGGACGAAGCTGGAGCTATATCCGCCGATGGCAAGTGTCGCTCCTTCGATGAGACAGCCAGCGGC
TATGGTAGAGGAGAAGGAGCAGGCGTCGTGATCCTCAAGCGATTGGACAAGGCACTTGCAGATGGCGACCATGTG
CTGGCTGTGCTCAAGGGCAGTGCAGTCGCTTCGGATGGCAAGACCTTGGGGATCATGGCCCCCAATGCGCGTGCC
CAACTACTAGTGGCCCAGAAGGCCCTCGCAGAGGCCAAAGTGTCTGCTGACTCGATCAACTACGTCGAAGCTCAT
GCAACGTCCACATCCCTGGGCGATCCAACCGAAACCAACGCTCTGGCAGAAGTCTATGGTGCGGGATCGGGGCGC
AGCCCATCTGATCCCTGTTATATCGGCTCCATCAAACCCAACATTGGTCATTTGGAGGCCGGTGCCGGAGTGATG
GGACTCATCAAAGCGGTACTGGTTCTTCGCCACGGCCAGGTTCCCCCGCAGGCCAATCTCAAGACGCTGAATAGC
AAAATTGCCTGGAACGAGAATCTGCTGTGTCCACCGCGCGAGCTGGTGACCTTGCCGTGCCCGGGGCCGATTCAT
CCTTTACGCGCGGCCGTGGCATCATACGGATATAGTGGTACTGTGTCGCACGCGGTACTCGAAGCATTTGCAGGA
CACTCCGAATTTGCCGAACGTCTGTCGCAGATCCCTACCGGCGATGATCCTTCGCCCGTTCTTCTCCTCATTTCC
GCACCCCAGGCTCGTCGGGTTTCCGCCGCCGCGGGCGCTCTAAAGCAGTGGCTTAGCGAGAATGAAGCATCTATA
TCTCTGAAGACCGTCTCGTCGACTCTGGCTCAACGCCGGGCTCACCATCGCTATCGCCATGCCATTGTGGCGGAC
TCCGTCCCCGATGCCATTGCCGCACTCGATGATGTTAGCAAGGAGGCACCGAATCGATGGGTTATCAAGGACAAG
ATCGATGCTAAGGCCGTTAAGGGCCCAGTGTGGATCTTTTCTGGTCATGGTGCGCAGTGGGCAGACATGGGCCGT
GAGTTATTCGAATCGAGTCCGGCATTCGAGGAGGTGGTCCGCAACCTAGAGCCCATCATCCAGGATGAGGTAGGA
TTCTCCGCCATTGAAATTCTGCAAAAGGGATGCCCCGATCGCTCCGACGTGGTACAGGTCATGACGTTCCTGATG
CATCTTGGCATTGCAGCCGTCCTAGAGATTGAGTCAGGGCCTCCCAGTGCTGTCGTGGGCCACTCCCTAGGCGAG
GCCGCCGCAGCCGTGGTGTCCGGCGCTTTGACCTGGCGCGAAGGGGCTCTCGTCGTGTGCCGTCGGGCGCGGCTA
TATCGCGAGCTCATGGGGCAAGGCGCTATGGCTCTAGTGCGAGTATCTACTGAGGAGGCTCGTACCCGTATTGGC
AGGCAAACTGGAGTTTGGGTAGCGATTGAAACATCCCCTAGCGCGTGTGTTTTGTCTGGTGAGGTGGACGCCGTT
AAGCAACTCTCAGATCGGTGGCGCGAGGAGGGAATTGAGGTGCGTATGGTCGCCTCGGACGTGCCCTTCCATACG
CCAATGCTGGAGAGATTGGCCAAGCCTCTTTATGAGTCGCTACGGGGAGAGCTTCATCCCCGTGTCCCCAACCGG
GCGCTCTTTTCGACCTCGCAGCCGGATCCCCGTTCCGAGGTTTTGCGCGATGCCCAGTACTGGGTGACCAACATG
ATTCAGCCCGTTCGGCTGCAGTCTGCTATCGCTGCCATTGCACAAGATGGCTTCCGTGCCCTGGTGGAAGTGTCT
AGCCACCCCATCGTGACACACTCCGTCGTGGAAACTATGGGGGAATGTACCGAGGACCCCGTTCTCGTCACCCCT
ACCATGGTACGTCGCCAGCCTGCGCTAAAGAGCATTTTGGCCGCGACAGGTCGACTGCATTGCTTCGGTTGTGCC
ATCAAATTTATTGAGTTGGACCCTAATGCGCCTTGGAACTCGAGCGTACCCAGTACTGTCTGGCACCATCAACCA
TTCTATCGAGCCGTGAGCCAAACATCGGCATCATCCCAACTCGAAACCACCCACGACCCGGCTGCTAACAACCTT
TTGGGGAAGCGCATCGCCCTTTGGGGTACAGAAGAGGTGCTGTATCAGACCCGCTTAGAGGAGGAGAACCGGCCA
TTTCCCGGTCATCACCCGCTCCATGGTTCCGAGATCGTGCCGGCGGCGGTGTTGCTACGCACATTCCTGCAGGCT
CTGACGCCCCGGTGTGTAGAGCAGGTGTCGCTTCAAGTCCCGGTTGTGGTGTCGCCGGCTCGCAAGGTCCAGATC
CGCCACAACACCCGCAACATTACAATCACTTCGTGCCTGGAGGAGTCGAGCAGCCAAGAGGATGGGTCCTGGTTG
GTAAACACCACGGCTGCAGTGGGTGCCGCGAATGTTGTGCCTAGTCAGAGTCGTATGGACCTGTCAGAGTTGCGC
AAGCGATTGCCTCAAAAGCTGGCTGACAGCTTTTCCATTGACTACCTAGCATCCGTAGGTGTATCTGCCATGGGC
TTTCCGTGGCAAGTGACCCACCATGTCGCCAGCGACGACGAGATGCTGGCACGGGTAGACGCAAACCCGGATAAT
ATGGGAGGGATGAATGACTTCTTGACCTCGCTCATGGATGCTGCGACCTCGATCTCCTCTACTCTTTGGCACCGC
CAGCCTCTGCTTCGCATGCCCACGTCAGTGCGTCGTGTCGTTGCCGTCCACGAGATCCCTATCCCGCGAGTAGTC
TACATCCACTGCACGAAAGTCGCATCCACCAGCGAGTGCACCGCTGATGTGACCCTTACTGGCGAGGATGGCACA
GTCTTGATGGAGATCCAGGGCATGTCATTTGCCGGTTTAGAGGGCGAGAGTTTCTCGCGAAAGAGCACTGCAGGT
CTAGTCCACCAGATTCAATGGCCTCCGGCAGCACTTGTCGAGGACCCTTCGGAATTCAGTCACATCGCCTTTGTC
ACGCCAGACATCACCGATCCTCGGCTGGAACAATATCAGAGCCAGCTCGATGCGCTGGCCATCACCTCCTCCGTC
CACCAGGCCGCTTCGGACCTACCCTTGACCAGTCATACCTCTCTCGCGGTGGTCTATCTGCCACAGACCATGACA
GATGTCTTTGATACGGCAACCAGATCCTGTAATGACCTTGTTTCCATCATACAGACTATCACTGCGGCTGCTTCT
TCAACTACGCGTGTCTTCGTCCTCACCGCAGGAACCGAACTCGGTCACAGCGCTCTTTTGGGTCTCAGCCGAATC
ATCCAGGCTGAACACCCTGACATCTGGGGTAGTCTCATTGAGGTCGAAGACACTTTCTCTCTCCCACTTATGGCC
ATGCGCTATGTTCGGGATGCCGATGTGATCAGGATCAAAGATGGCGTCCCACGCATTGCTCGTCTTCGGCCGCTT
CCATCTGCTTCTTCCTCCTTAACGCCTCTCACCTTCTCTCCGGCCTCGACCTATCTCATCACCGGCGGACTGGGT
GCTCTTGGACTGTCAGTTGCCCACTGGATGGTTACCCAAGGCGCTCGGCGGCTCCTCTTGCTATCTCGTCGCGCT
CTTCCTCCGCGCAGCACATGGTCTTCCACGCATATGAACAATCCTACCATCCAAAGCATTTTGGCCCTCGAACGC
CTCGGAGCCACGGTCCACTGCCTTCCCATCGACATCTCTCTGCCCATGGCTGCCTCCGGACTTCGGTCCACCCTG
GAGACTCTGAACCTTCCTTCCGTAGCTGGTGTTATCCATGCCGCTGGAATTGTCAGTGACCAGCTCGTTGAGCAA
GTGACTCCGGATGTCCTGGAGTCTGTACTAGCGCCTAAGATCAAAGGTGCTCTCAACTTACATGATGTCTTCCCT
CCAGCGTCCCTGGACTTCTTTGTTCTGTTCTCCTCATGCGGTCAGCTACTCGGATTTCCCGGGCAAGCATCGTAC
GCCAGCGGAAACGCCTTTCTCGATGGCCTCGCTCGGTCTCGCAGAGCCCAGGGCGATAATGCCATCTCGCTGCTC
TGGACCACGTGGCGTGGAATGGGCATGGGGCAGTCCGCCAACGGCGCGATGGAAGCGGAGCTCTATGCGCGCGGA
ATCACCGATATCACACCCGACGAAGCGTTCCGGGCCTGGAGTGCCGTGGCATCCACTGGTGGCGGAGGCACAGAT
CATGCAGTAATTGTGCGAGCGAGAGTGTTAGAAGGTGGAGAGCCCTTGCCCCATCCTATCCTTACGGACATCGCT
ACAAGGAAGGCAGAGGTTGTCAATGCTGGAGAGCATCCCGCGGGTAGCCAGGAAGTGAAGTTGAGTGGAAGGGAG
TTGGAGCAACATCTCCGGGATGTCATTAATGGATGTGTATCGAAGACATTGTCTGTCAAGGAGGACGAGATTGAT
GATGCTGTGGCATTGGCAGAGATGGGTATGGATTCAGTGATGACGGTCAATTTCCGAATGACCCTGCAACAGACG
CTCAAAGTGCCAGTCGGGCCAACGTTAATCTGGAAATGCCCGACTGTGCAGCATTTGGTGAAGCACTTTACAAAG
GAGCTGGATGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail