Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6428.t1
Gene name
Locationscaffold_040:39265..40096
Strand+
Gene length (bp)831
Transcript length (bp)723
Coding sequence length (bp)723
Protein length (aa) 241

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6428.t1
MDKKYKGRMKVDDRPDGLYMRIVAQHVGRGRSRERFRNARSVHDAFARITERGAKRLQGERTYKRPTDDLILTKE
DLLDADPCTVLTMNATWDKLQALPDLRHESKFIQAFFDTVLFNYQRELEQGPMVELSLNKILVEIQAPTKPPSQN
FALSVVVKTPSDFIGNVIGCSDAVTKGILAPTLGKVLVIDEAYMLGGTSSASDGVTGLDIFKTAVIYIPVAQTQS
VPGDGRCVRLWDICT*
Coding >Ani_SJS100_1|g6428.t1
ATGGACAAGAAATATAAGGGACGAATGAAGGTGGACGATAGGCCGGATGGACTATACATGCGCATTGTCGCACAG
CATGTTGGTCGCGGCCGCAGTCGTGAAAGGTTTAGAAACGCTCGTAGCGTCCACGATGCCTTCGCGCGTATCACA
GAGCGTGGGGCAAAACGATTGCAAGGGGAACGGACATATAAAAGGCCCACCGACGATCTGATTCTAACAAAGGAG
GATCTTCTCGATGCGGACCCGTGCACGGTGCTTACAATGAACGCCACTTGGGACAAGCTGCAAGCCCTGCCAGAT
CTCCGCCACGAGAGCAAGTTTATCCAAGCTTTTTTCGACACGGTTCTCTTTAACTACCAACGCGAGCTGGAGCAA
GGACCCATGGTGGAGTTATCGCTCAATAAGATCTTGGTGGAAATTCAGGCGCCGACAAAACCACCGTCGCAAAAC
TTCGCCTTGTCAGTCGTCGTCAAAACCCCCTCTGACTTCATCGGGAACGTCATTGGGTGCTCAGATGCCGTGACG
AAGGGCATCCTGGCCCCCACCCTTGGCAAAGTTCTAGTCATCGACGAAGCGTACATGCTAGGTGGGACTTCCTCA
GCTTCAGACGGGGTTACTGGTCTGGATATATTCAAGACCGCGGTTATCTACATTCCGGTTGCACAAACGCAAAGC
GTCCCCGGTGATGGTCGCTGTGTCCGCCTCTGGGATATATGCACGTAA
Transcript >Ani_SJS100_1|g6428.t1
ATGGACAAGAAATATAAGGGACGAATGAAGGTGGACGATAGGCCGGATGGACTATACATGCGCATTGTCGCACAG
CATGTTGGTCGCGGCCGCAGTCGTGAAAGGTTTAGAAACGCTCGTAGCGTCCACGATGCCTTCGCGCGTATCACA
GAGCGTGGGGCAAAACGATTGCAAGGGGAACGGACATATAAAAGGCCCACCGACGATCTGATTCTAACAAAGGAG
GATCTTCTCGATGCGGACCCGTGCACGGTGCTTACAATGAACGCCACTTGGGACAAGCTGCAAGCCCTGCCAGAT
CTCCGCCACGAGAGCAAGTTTATCCAAGCTTTTTTCGACACGGTTCTCTTTAACTACCAACGCGAGCTGGAGCAA
GGACCCATGGTGGAGTTATCGCTCAATAAGATCTTGGTGGAAATTCAGGCGCCGACAAAACCACCGTCGCAAAAC
TTCGCCTTGTCAGTCGTCGTCAAAACCCCCTCTGACTTCATCGGGAACGTCATTGGGTGCTCAGATGCCGTGACG
AAGGGCATCCTGGCCCCCACCCTTGGCAAAGTTCTAGTCATCGACGAAGCGTACATGCTAGGTGGGACTTCCTCA
GCTTCAGACGGGGTTACTGGTCTGGATATATTCAAGACCGCGGTTATCTACATTCCGGTTGCACAAACGCAAAGC
GTCCCCGGTGATGGTCGCTGTGTCCGCCTCTGGGATATATGCACGTAA
Gene >Ani_SJS100_1|g6428.t1
ATGGACAAGAAATATAAGGGACGAATGAAGGTGGACGATAGGCCGGATGGACTATACATGCGCATTGTCGCACAG
CATGTTGGTCGCGGCCGCAGTCGTGAAAGGTTTAGAAACGCTCGTAGCGTCCACGATGCCTTCGCGCGTATCACA
GAGCGTGGGGCAAAACGATTGCAAGGGGAACGGACATATAAAAGGCCCACCGACGATCTGATTCTAACAAAGGAG
GATCTTCTCGATGCGGACCCGTGCACGGTGCTTACAATGAACGCCACTTGGGACAAGCTGCAAGCCCTGCCAGAT
CTCCGCCACGAGAGCAAGTTTATCCAAGCTTTTTTCGACACGGTTCTCTTTAACTACCAACGCGAGCTGGAGCAA
GGACCCATGGTGGAGTTATCGCTCAATAAGATCTTGGTGGAAATTCAGGCGCCGACAAAACCACCGTCGCAAAAC
TGTACAGTAAGCTCCTGGCTGAAATGGGATATCATTCAAATGGAGAAGGTAATAGTTGACCCGCCGCCTGTCTAT
CTATGCCTACAAAAATCCCGTTGACTGACATTAGTCGCCTTGTCAGTCGTCGTCAAAACCCCCTCTGACTTCATC
GGGAACGTCATTGGGTGCTCAGATGCCGTGACGAAGGGCATCCTGGCCCCCACCCTTGGCAAAGTTCTAGTCATC
GACGAAGCGTACATGCTAGGTGGGACTTCCTCAGCTTCAGACGGGGTTACTGGTCTGGATATATTCAAGACCGCG
GTTATCTACATTCCGGTTGCACAAACGCAAAGCGTCCCCGGTGATGGTCGCTGTGTCCGCCTCTGGGATATATGC
ACGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail