Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g638.t1
Gene name
Locationscaffold_002:614784..616566
Strand+
Gene length (bp)1782
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00266 Aminotran_5 Aminotransferase class-V 1.3E-94 116 480
PF01212 Beta_elim_lyase Beta-eliminating lyase 1.6E-06 156 294
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 1.6E-05 164 297

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g638.t1
MSTMTPTALRQASRAYARRLLSTPHGSLTASLPRRVVATSAAIPRRSYVSETKAGNAQVTVDTAIKQDQKAFVNQ
TGLNAQKVNLPGSGISGDASMSPTAGILKQATVMDQGTRPVYLDMQATTPTDPRVLDAMLPYLTGIYGNPHSRTH
AYGWESEKAVEQAREHVAKLIGADPKEIIFTSGATESNNMSIKGVARFFGRSGKKKHIITTQTEHKCVLDSCRHL
QDEGFDVTYLPVQSNGLIRMEELEAAIRPDTALVSIMAVNNEIGVIQPMEEIGKLCRSKKIFFHTDGAQAVGKIP
LDVNKLNIDLMSISSHKIYGPKGMGACYVRRRPRVRLEPIISGGGQERGLRSGTIAPHLVVGFGEACRIAYEDME
YDSKHIARLSKRLSDGLLAMEHTTLNGDPDRHYPGCVNISFAYIEGESLLMALKDIALSSGSACTSASLEPSYVL
RALGSSDESAHSSIRFGIGRFTTDSEIDYVLKAVQDRVHFLRELSPLWEMVQEGIDLNSIEWSQH*
Coding >Ani_SJS100_1|g638.t1
ATGTCTACTATGACCCCTACTGCCTTGAGACAGGCATCTCGGGCTTATGCCCGTCGGCTTTTGTCGACTCCGCAT
GGCTCTCTGACAGCATCCCTGCCCCGGCGGGTGGTCGCCACCAGCGCTGCTATCCCCAGACGGTCGTACGTCTCC
GAAACCAAGGCTGGAAATGCCCAGGTTACGGTGGACACGGCCATCAAGCAGGACCAGAAGGCTTTTGTGAACCAG
ACTGGACTTAATGCGCAGAAGGTCAATCTTCCTGGTTCGGGCATCTCCGGCGATGCGTCCATGAGCCCTACCGCC
GGCATTCTGAAGCAGGCGACTGTTATGGACCAGGGCACCCGCCCGGTCTACCTCGACATGCAGGCGACGACCCCG
ACGGATCCCCGTGTCCTTGACGCCATGCTTCCCTACCTTACCGGCATCTACGGAAACCCCCATTCCAGAACTCAC
GCCTACGGCTGGGAGTCCGAGAAAGCCGTTGAACAAGCCAGAGAACACGTCGCCAAGCTTATCGGCGCCGACCCC
AAGGAAATCATCTTCACCAGCGGCGCTACTGAGAGCAACAACATGAGCATCAAGGGTGTCGCCAGATTCTTCGGT
CGCTCTGGCAAGAAGAAGCACATCATCACCACCCAGACCGAGCACAAGTGTGTCTTGGACAGCTGCAGGCACTTG
CAAGACGAGGGATTCGACGTGACATACCTGCCCGTGCAGAGCAATGGATTGATCCGCATGGAAGAATTGGAGGCG
GCCATTCGTCCCGACACTGCCCTGGTCAGTATCATGGCCGTCAACAATGAGATTGGTGTCATTCAACCCATGGAG
GAGATCGGAAAGCTTTGCCGCTCGAAGAAGATCTTCTTCCACACCGATGGTGCCCAGGCCGTGGGCAAGATTCCG
TTGGATGTCAACAAGCTCAACATCGATTTGATGTCGATTTCCAGCCACAAGATCTATGGCCCTAAGGGTATGGGT
GCATGCTATGTTCGCCGTAGGCCCAGAGTTCGTCTCGAGCCTATCATTTCCGGAGGTGGACAGGAGAGAGGTCTC
CGCAGTGGCACCATTGCCCCCCACCTCGTAGTCGGATTTGGCGAGGCTTGCCGTATTGCATACGAGGACATGGAG
TATGACTCCAAGCACATCGCAAGGCTGTCGAAGCGCCTGAGCGACGGACTTTTGGCCATGGAGCACACCACGCTC
AACGGAGATCCTGACCGCCACTACCCCGGTTGCGTTAACATCTCCTTTGCCTACATTGAAGGCGAGTCGCTTCTG
ATGGCGCTGAAGGACATTGCCCTCTCATCCGGCAGTGCCTGCACGTCTGCCTCCTTGGAGCCCAGCTACGTCCTG
CGGGCTCTGGGCAGCAGCGATGAGAGTGCCCACAGCAGTATCCGATTCGGTATCGGCCGGTTCACGACCGACAGT
GAGATTGACTACGTGCTCAAGGCGGTGCAAGACCGCGTCCACTTCCTGCGGGAACTGAGCCCGCTGTGGGAGATG
GTTCAGGAGGGTATCGATTTGAACTCGATTGAATGGAGCCAGCACTAA
Transcript >Ani_SJS100_1|g638.t1
ATGTCTACTATGACCCCTACTGCCTTGAGACAGGCATCTCGGGCTTATGCCCGTCGGCTTTTGTCGACTCCGCAT
GGCTCTCTGACAGCATCCCTGCCCCGGCGGGTGGTCGCCACCAGCGCTGCTATCCCCAGACGGTCGTACGTCTCC
GAAACCAAGGCTGGAAATGCCCAGGTTACGGTGGACACGGCCATCAAGCAGGACCAGAAGGCTTTTGTGAACCAG
ACTGGACTTAATGCGCAGAAGGTCAATCTTCCTGGTTCGGGCATCTCCGGCGATGCGTCCATGAGCCCTACCGCC
GGCATTCTGAAGCAGGCGACTGTTATGGACCAGGGCACCCGCCCGGTCTACCTCGACATGCAGGCGACGACCCCG
ACGGATCCCCGTGTCCTTGACGCCATGCTTCCCTACCTTACCGGCATCTACGGAAACCCCCATTCCAGAACTCAC
GCCTACGGCTGGGAGTCCGAGAAAGCCGTTGAACAAGCCAGAGAACACGTCGCCAAGCTTATCGGCGCCGACCCC
AAGGAAATCATCTTCACCAGCGGCGCTACTGAGAGCAACAACATGAGCATCAAGGGTGTCGCCAGATTCTTCGGT
CGCTCTGGCAAGAAGAAGCACATCATCACCACCCAGACCGAGCACAAGTGTGTCTTGGACAGCTGCAGGCACTTG
CAAGACGAGGGATTCGACGTGACATACCTGCCCGTGCAGAGCAATGGATTGATCCGCATGGAAGAATTGGAGGCG
GCCATTCGTCCCGACACTGCCCTGGTCAGTATCATGGCCGTCAACAATGAGATTGGTGTCATTCAACCCATGGAG
GAGATCGGAAAGCTTTGCCGCTCGAAGAAGATCTTCTTCCACACCGATGGTGCCCAGGCCGTGGGCAAGATTCCG
TTGGATGTCAACAAGCTCAACATCGATTTGATGTCGATTTCCAGCCACAAGATCTATGGCCCTAAGGGTATGGGT
GCATGCTATGTTCGCCGTAGGCCCAGAGTTCGTCTCGAGCCTATCATTTCCGGAGGTGGACAGGAGAGAGGTCTC
CGCAGTGGCACCATTGCCCCCCACCTCGTAGTCGGATTTGGCGAGGCTTGCCGTATTGCATACGAGGACATGGAG
TATGACTCCAAGCACATCGCAAGGCTGTCGAAGCGCCTGAGCGACGGACTTTTGGCCATGGAGCACACCACGCTC
AACGGAGATCCTGACCGCCACTACCCCGGTTGCGTTAACATCTCCTTTGCCTACATTGAAGGCGAGTCGCTTCTG
ATGGCGCTGAAGGACATTGCCCTCTCATCCGGCAGTGCCTGCACGTCTGCCTCCTTGGAGCCCAGCTACGTCCTG
CGGGCTCTGGGCAGCAGCGATGAGAGTGCCCACAGCAGTATCCGATTCGGTATCGGCCGGTTCACGACCGACAGT
GAGATTGACTACGTGCTCAAGGCGGTGCAAGACCGCGTCCACTTCCTGCGGGAACTGAGCCCGCTGTGGGAGATG
GTTCAGGAGGGTATCGATTTGAACTCGATTGAATGGAGCCAGCACTAA
Gene >Ani_SJS100_1|g638.t1
ATGTCTACTATGACCCCTACTGCCTTGAGACAGGCATCTCGGGCTTATGCCCGTCGGCTTTTGTCGACTCCGCAT
GGCTCTCTGACAGCATCCCTGCCCCGGCGGGTGGTCGCCACCAGCGCTGCTATCCCCAGACGGTCGTACGTCTCC
GAAACCAAGGCTGGAAATGCCCAGGTTACGGTGGACACGGCCATCAAGCAGGACCAGAAGGCTTTTGTGAACCAG
ACTGGACTTAATGCGCAGAAGGTCAATCTTCCTGGTTCGGGCATCTCCGGCGATGCGTCCATGAGCCCTACCGCC
GGCATTCTGAAGCAGGCGACTGTTATGGACCAGGGCACCCGCCCGGTCTACCTCGACATGCAGGCGACGACCCCG
ACGGATCCCCGTGTCCTTGACGCCATGCTTCCCTACCTTACCGGCATCTACGGAAACCCCCATTCCAGAACTCAC
GCCTACGGCTGGGAGTCCGAGAAAGCCGTTGAACAAGCCAGAGAACACGTCGCCAAGCTTATCGGCGCCGACCCC
AAGGAAATCATCTTCACCAGCGGCGCTACTGAGAGCAACAACATGAGCATCAAGGGTGTCGCCAGATTCTTCGGT
CGCTCTGGCAAGAAGAAGCACATCATCACCACCCAGACCGAGCACAAGTGTGTCTTGGACAGCTGCAGGCACTTG
CAAGACGAGGGATTCGACGTGACATACCTGCCCGTGCAGAGCAATGGATTGATCCGCATGGAAGAATTGGAGGCG
GCCATTCGTCCCGACACTGCCCTGGTCAGTATCATGGCCGTCAACAATGAGATTGGTGTCATTCAACCCATGGAG
GAGATCGGAAAGCTTTGCCGCTCGAAGAAGATCTTCTTCCACACCGATGGTGCCCAGGCCGTGGGCAAGATTCCG
TTGGATGTCAACAAGCTCAACATCGATTTGATGTCGATTTCCAGCCACAAGATCTATGGCCCTAAGGGTATGGGT
GCATGCTATGTTCGCCGTAGGCCCAGAGTTCGTCTCGAGCCTATCATTTCCGGAGGTGGACAGGAGAGAGGTCTC
CGCAGTGGCACCATTGCCCCCCACCTCGTAGTCGGATTTGGCGAGGCTTGCCGTATTGCATACGAGGACATGGAG
GTACGTTCCACTTTTTTTCTTTTAACCTCGAATTTGCTCTCAGTCAGGATGTTTCCGCGATGATTATAAGCTCTA
ATATGTATCGATTAACTGAGGCGCCATGGGGGTAGCGACACGCTTTGCGTGTCCCCATGGTGCTTTGACGACCGT
AGCAGGGGTGATGAGTCGGGTTGCTGCATTTGCTTGTTGCGAGACAGTGAAGTCGATGAGAAAGTAGCTGACCAA
TATGCACAGTATGACTCCAAGCACATCGCAAGGCTGTCGAAGCGCCTGAGCGACGGACTTTTGGCCATGGAGCAC
ACCACGCTCAACGGAGATCCTGACCGCCACTACCCCGGTTGCGTTAACATCTCCTTTGCCTACATTGAAGGCGAG
TCGCTTCTGATGGCGCTGAAGGACATTGCCCTCTCATCCGGCAGTGCCTGCACGTCTGCCTCCTTGGAGCCCAGC
TACGTCCTGCGGGCTCTGGGCAGCAGCGATGAGAGTGCCCACAGCAGTATCCGATTCGGTATCGGCCGGTTCACG
ACCGACAGTGAGATTGACTACGTGCTCAAGGCGGTGCAAGACCGCGTCCACTTCCTGCGGGAACTGAGCCCGCTG
TGGGAGATGGTTCAGGAGGGTATCGATTTGAACTCGATTGAATGGAGCCAGCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail